DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and Ncam2

DIOPT Version :10

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001106679.1 Gene:Ncam2 / 17968 MGIID:97282 Length:837 Species:Mus musculus


Alignment Length:454 Identity:105/454 - (23%)
Similarity:175/454 - (38%) Gaps:84/454 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LIYMTNLVTHVMMDEPRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVI 93
            :|.:.|:...:||.:..|     |.|...|.:..|.|.........::|..         :..:|
Mouse   201 IIVIVNVPPAIMMPQKSF-----NATAERGEEMTLTCKASGSPDPTISWFR---------NGKLI 251

  Fly    94 SRIPRYSITYTDNTWLLHVNQAHQDDRGYYMCQVNTNPMISQ-VGYLQVVVPPNILDIESTPSSV 157
            ....:| |....||.|. |......|.|.|:|:........| ..:|||.|.|:||.:::..:| 
Mouse   252 EENEKY-ILKGSNTELT-VRNIINKDGGSYVCKATNKAGEDQKQAFLQVFVQPHILQLKNETTS- 313

  Fly   158 AVRENQNINMTCRADGFPAPKIIWRR-------EDGEEI---AVEKKKKVLVYDADVLPLTKVSR 212
               ||.::.:.|.|:|.|.|:|.|:|       .:|::.   .:|.|.:   :....|.:..|..
Mouse   314 ---ENGHVTLVCEAEGEPVPEITWKRAIDGVMFSEGDKSPDGRIEVKGQ---HGRSSLHIRDVKL 372

  Fly   213 NEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQ-LVGAPSGTDVTIDCHTEAHPKAIIYWV 276
            ::.|.|.|.|.:.: ....:.:.||:|::|. :|.|| :..:..|..:.|.|...|:|.|.|:| 
Mouse   373 SDSGRYDCEAASRI-GGHQRSMHLDIEYAPK-FVSNQTMYYSWEGNPINISCDVTANPPASIHW- 434

  Fly   277 YNSVMVLPSKKYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPST 341
            ....::||:|. .|....:|....|.|.|......|||.|.|.:.|.:|.   ..:.|.:.|...
Mouse   435 RREKLLLPAKN-TTHLKTHSVGRKMILEIAPTSDNDFGRYNCTATNRIGT---RFQEYILELADV 495

  Fly   342 PSK-------QVTHTTVESRENNIIPSSRNDT-TKSLQTDVGYAMKNDLYPGSASSSSSGGSSSA 398
            ||.       :::.||.:...|.  |.|.... ....|.||                     ...
Mouse   496 PSSPHGVKIIELSQTTAKISFNK--PESHGGVPIHHYQVDV---------------------KEV 537

  Fly   399 ASS------SSSMQTSALPGGVAGNS-----LSSMGSKGSLAIGKSTFYTERPPNEYAASSVAG 451
            ||.      |..:||..:...:..|:     ::::..||.....|...:...|..|.:..|:.|
Mouse   538 ASETWKIVRSHGVQTMVVLSSLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIHG 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 21/92 (23%)
Ig strand B 61..65 CDD:409353 1/3 (33%)
Ig strand C 74..78 CDD:409353 0/3 (0%)
Ig strand E 105..112 CDD:409353 3/6 (50%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 1/3 (33%)
Ig 145..238 CDD:472250 24/102 (24%)
Ig strand B 165..169 CDD:409353 0/3 (0%)
Ig strand C 178..182 CDD:409353 1/3 (33%)
Ig strand E 203..207 CDD:409353 1/3 (33%)
Ig strand F 217..222 CDD:409353 2/4 (50%)
Ig strand G 231..234 CDD:409353 0/2 (0%)
Ig 242..333 CDD:472250 27/91 (30%)
Ig strand B 259..263 CDD:409353 1/3 (33%)
Ig strand C 272..276 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 3/9 (33%)
Ig strand F 315..320 CDD:409353 2/4 (50%)
Ig strand G 328..331 CDD:409353 0/2 (0%)
Ncam2NP_001106679.1 IgI_1_NCAM-2 21..113 CDD:409452
Ig strand A 21..26 CDD:409452
Ig strand A' 29..33 CDD:409452
Ig strand B 35..45 CDD:409452
Ig strand C 49..55 CDD:409452
Ig strand C' 58..60 CDD:409452
Ig strand D 66..72 CDD:409452
Ig strand E 74..82 CDD:409452
Ig strand F 89..96 CDD:409452
Ig strand G 101..112 CDD:409452
IG_like 122..187 CDD:214653
Ig strand B 132..136 CDD:409353
Ig strand C 145..152 CDD:409353
Ig strand E 169..173 CDD:409353
Ig strand F 183..187 CDD:409353
Ig strand G 191..194 CDD:409353
IgI_1_MuSK 209..298 CDD:409562 22/104 (21%)
Ig strand A 209..212 CDD:409562 0/2 (0%)
Ig strand A' 217..222 CDD:409562 2/9 (22%)
Ig strand B 228..235 CDD:409562 2/6 (33%)
Ig strand C 241..246 CDD:409562 1/4 (25%)
Ig strand C' 248..250 CDD:409562 0/1 (0%)
Ig strand D 257..260 CDD:409562 2/3 (67%)
Ig strand E 264..270 CDD:409562 3/6 (50%)
Ig strand F 277..284 CDD:409562 3/6 (50%)
Ig strand G 290..298 CDD:409562 2/7 (29%)
Ig 300..397 CDD:472250 25/104 (24%)
Ig strand B 318..322 CDD:409353 0/3 (0%)
Ig strand C 331..335 CDD:409353 1/3 (33%)
Ig strand E 363..367 CDD:409353 1/3 (33%)
Ig strand F 377..382 CDD:409353 2/4 (50%)
Ig strand G 390..393 CDD:409353 0/2 (0%)
Ig_3 401..479 CDD:464046 25/80 (31%)
FN3 496..588 CDD:238020 19/114 (17%)
fn3 594..678 CDD:394996 2/8 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 764..810
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.