DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and Ncam2

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001106679.1 Gene:Ncam2 / 17968 MGIID:97282 Length:837 Species:Mus musculus


Alignment Length:454 Identity:105/454 - (23%)
Similarity:175/454 - (38%) Gaps:84/454 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LIYMTNLVTHVMMDEPRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVI 93
            :|.:.|:...:||.:..|     |.|...|.:..|.|.........::|..         :..:|
Mouse   201 IIVIVNVPPAIMMPQKSF-----NATAERGEEMTLTCKASGSPDPTISWFR---------NGKLI 251

  Fly    94 SRIPRYSITYTDNTWLLHVNQAHQDDRGYYMCQVNTNPMISQ-VGYLQVVVPPNILDIESTPSSV 157
            ....:| |....||.|. |......|.|.|:|:........| ..:|||.|.|:||.:::..:| 
Mouse   252 EENEKY-ILKGSNTELT-VRNIINKDGGSYVCKATNKAGEDQKQAFLQVFVQPHILQLKNETTS- 313

  Fly   158 AVRENQNINMTCRADGFPAPKIIWRR-------EDGEEI---AVEKKKKVLVYDADVLPLTKVSR 212
               ||.::.:.|.|:|.|.|:|.|:|       .:|::.   .:|.|.:   :....|.:..|..
Mouse   314 ---ENGHVTLVCEAEGEPVPEITWKRAIDGVMFSEGDKSPDGRIEVKGQ---HGRSSLHIRDVKL 372

  Fly   213 NEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQ-LVGAPSGTDVTIDCHTEAHPKAIIYWV 276
            ::.|.|.|.|.:.: ....:.:.||:|::|. :|.|| :..:..|..:.|.|...|:|.|.|:| 
Mouse   373 SDSGRYDCEAASRI-GGHQRSMHLDIEYAPK-FVSNQTMYYSWEGNPINISCDVTANPPASIHW- 434

  Fly   277 YNSVMVLPSKKYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPST 341
            ....::||:|. .|....:|....|.|.|......|||.|.|.:.|.:|.   ..:.|.:.|...
Mouse   435 RREKLLLPAKN-TTHLKTHSVGRKMILEIAPTSDNDFGRYNCTATNRIGT---RFQEYILELADV 495

  Fly   342 PSK-------QVTHTTVESRENNIIPSSRNDT-TKSLQTDVGYAMKNDLYPGSASSSSSGGSSSA 398
            ||.       :::.||.:...|.  |.|.... ....|.||                     ...
Mouse   496 PSSPHGVKIIELSQTTAKISFNK--PESHGGVPIHHYQVDV---------------------KEV 537

  Fly   399 ASS------SSSMQTSALPGGVAGNS-----LSSMGSKGSLAIGKSTFYTERPPNEYAASSVAG 451
            ||.      |..:||..:...:..|:     ::::..||.....|...:...|..|.:..|:.|
Mouse   538 ASETWKIVRSHGVQTMVVLSSLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIHG 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 21/92 (23%)
Ig 145..238 CDD:416386 24/102 (24%)
Ig strand A 145..149 CDD:409353 2/3 (67%)
Ig strand A' 154..159 CDD:409353 1/4 (25%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 2/4 (50%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 1/7 (14%)
Ig 242..333 CDD:416386 27/91 (30%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 2/6 (33%)
Ig strand C 272..277 CDD:409353 2/4 (50%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 3/9 (33%)
Ig strand F 314..322 CDD:409353 3/7 (43%)
Ig strand G 325..334 CDD:409353 1/8 (13%)
Ncam2NP_001106679.1 Ig1_NCAM-2 21..112 CDD:143274
I-set 22..111 CDD:254352
I-set 117..193 CDD:254352
IGc2 128..189 CDD:197706
Ig 208..301 CDD:299845 24/108 (22%)
I-set 215..298 CDD:254352 20/98 (20%)
Ig 300..397 CDD:299845 25/104 (24%)
IG_like 308..395 CDD:214653 20/94 (21%)
IG_like 413..491 CDD:214653 24/82 (29%)
IGc2 414..482 CDD:197706 22/69 (32%)
FN3 496..588 CDD:238020 19/114 (17%)
fn3 594..678 CDD:278470 2/8 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 764..810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.