DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and Ncam1

DIOPT Version :10

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_006510118.1 Gene:Ncam1 / 17967 MGIID:97281 Length:1162 Species:Mus musculus


Alignment Length:318 Identity:79/318 - (24%)
Similarity:131/318 - (41%) Gaps:42/318 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 QPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILT----IHRHVISRIPRYSITYTDNTW 108
            |.|.|.|..:|:...|.|..:......::|.. |.:.|..    ..:|:          ::|::.
Mouse   218 QSIVNATANLGQSVTLVCDADGFPEPTMSWTK-DGEPIENEEEDDEKHI----------FSDDSS 271

  Fly   109 LLHVNQAHQDDRGYYMCQVNTNPMISQVG--YLQVVVPPNILDIESTPSSVAVRENQNINMTCRA 171
            .|.:....::|...|:| :..|....|..  :|:|...|.|..:|   :..|:...:.:.:||.|
Mouse   272 ELTIRNVDKNDEAEYVC-IAENKAGEQDASIHLKVFAKPKITYVE---NQTAMELEEQVTLTCEA 332

  Fly   172 DGFPAPKIIWRREDGEEIAVEKK------KKVLVYDADV----------LPLTKVSRNEMGAYLC 220
            .|.|.|.|.||... ..|:.|:|      :|....|..:          |.|..:...:.|.|:|
Mouse   333 SGDPIPSITWRTST-RNISSEEKASWTRPEKQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYIC 396

  Fly   221 IATNGVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPS 285
            .|:|.:... |:.:.|:|:::|.:..| ..|....|..|.|.|...|:|.|.|.| :....:|||
Mouse   397 TASNTIGQD-SQSMYLEVQYAPKLQGP-VAVYTWEGNQVNITCEVFAYPSATISW-FRDGQLLPS 458

  Fly   286 KKYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPSTPS 343
            ..|......|:..|.. |.:......|||||.|.:.|.:|:......:.:...||:||
Mouse   459 SNYSNIKIYNTPSASY-LEVTPDSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPS 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 18/97 (19%)
Ig strand B 61..65 CDD:409353 1/3 (33%)
Ig strand C 74..78 CDD:409353 0/3 (0%)
Ig strand E 105..112 CDD:409353 2/6 (33%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 1/2 (50%)
Ig 145..238 CDD:472250 27/108 (25%)
Ig strand B 165..169 CDD:409353 0/3 (0%)
Ig strand C 178..182 CDD:409353 1/3 (33%)
Ig strand E 203..207 CDD:409353 1/13 (8%)
Ig strand F 217..222 CDD:409353 2/4 (50%)
Ig strand G 231..234 CDD:409353 1/2 (50%)
Ig 242..333 CDD:472250 27/90 (30%)
Ig strand B 259..263 CDD:409353 2/3 (67%)
Ig strand C 272..276 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 3/9 (33%)
Ig strand F 315..320 CDD:409353 3/4 (75%)
Ig strand G 328..331 CDD:409353 0/2 (0%)
Ncam1XP_006510118.1 IgI_1_NCAM-1 20..116 CDD:409451
Ig strand A 20..25 CDD:409451
Ig strand A' 28..32 CDD:409451
Ig strand B 34..44 CDD:409451
Ig strand C 50..56 CDD:409451
Ig strand C' 59..61 CDD:409451
Ig strand D 69..75 CDD:409451
Ig strand E 77..85 CDD:409451
Ig strand F 92..100 CDD:409451
Ig strand G 104..115 CDD:409451
IG_like 124..190 CDD:214653
Ig strand B 135..139 CDD:409353
Ig strand C 148..152 CDD:409353
Ig strand E 172..176 CDD:409353
Ig strand F 186..191 CDD:409353
IgI_3_NCAM-1 211..308 CDD:143207 20/101 (20%)
Ig strand A 211..216 CDD:143207
Ig strand A' 220..226 CDD:143207 3/5 (60%)
Ig strand B 229..239 CDD:143207 2/9 (22%)
Ig strand C 243..249 CDD:143207 1/5 (20%)
Ig strand C' 251..253 CDD:143207 0/1 (0%)
Ig strand D 263..266 CDD:143207 1/12 (8%)
Ig strand E 271..277 CDD:143207 1/5 (20%)
Ig strand F 283..292 CDD:143207 2/9 (22%)
Ig strand G 295..307 CDD:143207 3/11 (27%)
IgI_NCAM-1 307..413 CDD:143277 27/110 (25%)
Ig strand A 307..312 CDD:143277 1/4 (25%)
Ig strand A' 316..320 CDD:143277 0/3 (0%)
Ig strand B 325..333 CDD:143277 2/7 (29%)
Ig strand C 339..345 CDD:143277 3/5 (60%)
Ig strand C' 348..351 CDD:143277 1/2 (50%)
Ig strand D 369..375 CDD:143277 0/5 (0%)
Ig strand E 378..384 CDD:143277 1/5 (20%)
Ig strand F 392..400 CDD:143277 4/7 (57%)
Ig strand G 403..413 CDD:143277 2/10 (20%)
IG_like 422..500 CDD:214653 26/80 (33%)
Ig strand B 433..437 CDD:409353 2/3 (67%)
Ig strand C 446..450 CDD:409353 2/4 (50%)
Ig strand E 473..477 CDD:409353 1/4 (25%)
Ig strand F 487..492 CDD:409353 3/4 (75%)
fn3 512..599 CDD:394996 3/4 (75%)
fn3 649..731 CDD:394996
PHA03247 <905..1140 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.