| Sequence 1: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006510118.1 | Gene: | Ncam1 / 17967 | MGIID: | 97281 | Length: | 1162 | Species: | Mus musculus |
| Alignment Length: | 318 | Identity: | 79/318 - (24%) |
|---|---|---|---|
| Similarity: | 131/318 - (41%) | Gaps: | 42/318 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 48 QPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILT----IHRHVISRIPRYSITYTDNTW 108
Fly 109 LLHVNQAHQDDRGYYMCQVNTNPMISQVG--YLQVVVPPNILDIESTPSSVAVRENQNINMTCRA 171
Fly 172 DGFPAPKIIWRREDGEEIAVEKK------KKVLVYDADV----------LPLTKVSRNEMGAYLC 220
Fly 221 IATNGVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPS 285
Fly 286 KKYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPSTPS 343 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-delta | NP_001097508.2 | IG_like | 51..143 | CDD:214653 | 18/97 (19%) |
| Ig strand B | 61..65 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 74..78 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 105..112 | CDD:409353 | 2/6 (33%) | ||
| Ig strand F | 122..127 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 134..137 | CDD:409353 | 1/2 (50%) | ||
| Ig | 145..238 | CDD:472250 | 27/108 (25%) | ||
| Ig strand B | 165..169 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 178..182 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 203..207 | CDD:409353 | 1/13 (8%) | ||
| Ig strand F | 217..222 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 231..234 | CDD:409353 | 1/2 (50%) | ||
| Ig | 242..333 | CDD:472250 | 27/90 (30%) | ||
| Ig strand B | 259..263 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 272..276 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 295..305 | CDD:409353 | 3/9 (33%) | ||
| Ig strand F | 315..320 | CDD:409353 | 3/4 (75%) | ||
| Ig strand G | 328..331 | CDD:409353 | 0/2 (0%) | ||
| Ncam1 | XP_006510118.1 | IgI_1_NCAM-1 | 20..116 | CDD:409451 | |
| Ig strand A | 20..25 | CDD:409451 | |||
| Ig strand A' | 28..32 | CDD:409451 | |||
| Ig strand B | 34..44 | CDD:409451 | |||
| Ig strand C | 50..56 | CDD:409451 | |||
| Ig strand C' | 59..61 | CDD:409451 | |||
| Ig strand D | 69..75 | CDD:409451 | |||
| Ig strand E | 77..85 | CDD:409451 | |||
| Ig strand F | 92..100 | CDD:409451 | |||
| Ig strand G | 104..115 | CDD:409451 | |||
| IG_like | 124..190 | CDD:214653 | |||
| Ig strand B | 135..139 | CDD:409353 | |||
| Ig strand C | 148..152 | CDD:409353 | |||
| Ig strand E | 172..176 | CDD:409353 | |||
| Ig strand F | 186..191 | CDD:409353 | |||
| IgI_3_NCAM-1 | 211..308 | CDD:143207 | 20/101 (20%) | ||
| Ig strand A | 211..216 | CDD:143207 | |||
| Ig strand A' | 220..226 | CDD:143207 | 3/5 (60%) | ||
| Ig strand B | 229..239 | CDD:143207 | 2/9 (22%) | ||
| Ig strand C | 243..249 | CDD:143207 | 1/5 (20%) | ||
| Ig strand C' | 251..253 | CDD:143207 | 0/1 (0%) | ||
| Ig strand D | 263..266 | CDD:143207 | 1/12 (8%) | ||
| Ig strand E | 271..277 | CDD:143207 | 1/5 (20%) | ||
| Ig strand F | 283..292 | CDD:143207 | 2/9 (22%) | ||
| Ig strand G | 295..307 | CDD:143207 | 3/11 (27%) | ||
| IgI_NCAM-1 | 307..413 | CDD:143277 | 27/110 (25%) | ||
| Ig strand A | 307..312 | CDD:143277 | 1/4 (25%) | ||
| Ig strand A' | 316..320 | CDD:143277 | 0/3 (0%) | ||
| Ig strand B | 325..333 | CDD:143277 | 2/7 (29%) | ||
| Ig strand C | 339..345 | CDD:143277 | 3/5 (60%) | ||
| Ig strand C' | 348..351 | CDD:143277 | 1/2 (50%) | ||
| Ig strand D | 369..375 | CDD:143277 | 0/5 (0%) | ||
| Ig strand E | 378..384 | CDD:143277 | 1/5 (20%) | ||
| Ig strand F | 392..400 | CDD:143277 | 4/7 (57%) | ||
| Ig strand G | 403..413 | CDD:143277 | 2/10 (20%) | ||
| IG_like | 422..500 | CDD:214653 | 26/80 (33%) | ||
| Ig strand B | 433..437 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 446..450 | CDD:409353 | 2/4 (50%) | ||
| Ig strand E | 473..477 | CDD:409353 | 1/4 (25%) | ||
| Ig strand F | 487..492 | CDD:409353 | 3/4 (75%) | ||
| fn3 | 512..599 | CDD:394996 | 3/4 (75%) | ||
| fn3 | 649..731 | CDD:394996 | |||
| PHA03247 | <905..1140 | CDD:223021 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||