DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and rig-4

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_501339.2 Gene:rig-4 / 177597 WormBaseID:WBGene00004371 Length:2325 Species:Caenorhabditis elegans


Alignment Length:543 Identity:114/543 - (20%)
Similarity:175/543 - (32%) Gaps:179/543 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YMTNLVTHVMMDEPRFAQPIPN-VTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVIS 94
            |||.:...::.|       :|| :...||...:|.|.|:......:.|.                
 Worm   317 YMTFISRPILKD-------LPNEIQKTVGSSLSLKCSVKKKSSMDIKWY---------------- 358

  Fly    95 RIPRYSITYTDNTWLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQV------------------ 141
               :..:..|.....|.:::..|||.|.|.|:. ||...:.:..:.|                  
 Worm   359 ---KNGLMMTTQRGKLTIDRIKQDDFGLYQCEA-TNAAGADLASVWVKEGEANETVATEMSEDGM 419

  Fly   142 ---------VVPPNIL-----------------DIE------STPSSVAVRE-NQNINMTCRADG 173
                     ..||..|                 ::|      .||..:.|.. ...|.|.|.|.|
 Worm   420 SLEEEISMETPPPRKLKFFDNSKSQEQLFPFTSELEPSQKLIKTPKDLTVASGTDRIMMECAATG 484

  Fly   174 FPAPKIIWRREDGEEIAVEKKKKVLVYDA--DVLPLTKVSRNEMGAYLC-IATNGVPPSVSKRII 235
            .|.|.|||.. :|.||..:..|    ||.  |.|.:..:.:::.|.|.| |:.:.|..:.:.::.
 Worm   485 SPPPNIIWLL-NGHEIQTDNVK----YDLTNDGLAIHDIRKSDEGEYTCEISGSNVKATANVQVN 544

  Fly   236 LD--VEFSPMIWVPNQLVGAPSGTDVTIDCHT--EAHPKAIIYWVYNSVMVLP---------SKK 287
            .|  :|:.|.  ....|:    ||:|...|..  |...||.:.|..|.|: ||         |:.
 Worm   545 GDSLIEYGPA--DQKSLI----GTNVEFSCEVAKEYVRKASVEWYLNDVL-LPVNGNSGLRISRN 602

  Fly   288 YKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPSTPSK-------Q 345
            .|.           .|.||.:...:.|.|||.......|...|..:..|..|:.|.:       :
 Worm   603 RKG-----------SLIIRQVGPDNTGEYRCRVTVDGREENASAMLQIIEKPAMPERVRAELHNE 656

  Fly   346 VTHTTVESRENNIIPSSR------------------NDTTKSLQ------------TDVGYAMKN 380
            .....|..|.|.....:.                  :|.|.::.            ||:     .
 Worm   657 TMPAKVRVRWNEGFDGNEPIIKHAIEMRTMGPTGLWSDWTTAIDNIPKEEGKPCCWTDI-----E 716

  Fly   381 DLYPGS-------ASSSSSGGSSSAASSSSSM---QTSALPGGVAGNSLSSMGSKGSLAIGKSTF 435
            ||.|.|       ||:....|..|..|.|.:|   ..||.|..||    :|..|..|:.:     
 Worm   717 DLRPSSTAEFRVVASNKHGPGKPSLPSYSVTMPQQPPSAAPRNVA----ASARSPHSVMV----- 772

  Fly   436 YTERPPNEYAASSVAGLLLHRAL 458
            ..::|..|..:..|.|.::...|
 Worm   773 QWQQPKEELDSGDVLGYVVRYRL 795

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 19/119 (16%)
Ig 145..238 CDD:416386 30/121 (25%)
Ig strand A 145..149 CDD:409353 2/20 (10%)
Ig strand A' 154..159 CDD:409353 1/4 (25%)
Ig strand B 165..172 CDD:409353 3/6 (50%)
Ig strand C 178..183 CDD:409353 3/4 (75%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 1/3 (33%)
Ig strand E 203..209 CDD:409353 2/5 (40%)
Ig strand F 216..223 CDD:409353 4/7 (57%)
Ig strand G 230..238 CDD:409353 1/9 (11%)
Ig 242..333 CDD:416386 25/101 (25%)
Ig strand A' 250..253 CDD:409353 1/2 (50%)
Ig strand B 259..266 CDD:409353 2/8 (25%)
Ig strand C 272..277 CDD:409353 1/4 (25%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 1/9 (11%)
Ig strand F 314..322 CDD:409353 4/7 (57%)
Ig strand G 325..334 CDD:409353 2/8 (25%)
rig-4NP_501339.2 IG_like 330..402 CDD:214653 18/91 (20%)
IGc2 338..393 CDD:197706 15/74 (20%)
I-set 459..543 CDD:254352 26/88 (30%)
IGc2 478..534 CDD:197706 21/60 (35%)
IG_like 553..639 CDD:214653 25/103 (24%)
Ig 564..635 CDD:143165 20/82 (24%)
FN3 643..747 CDD:238020 19/108 (18%)
FN3 756..850 CDD:238020 11/49 (22%)
FN3 858..954 CDD:238020
FN3 959..1042 CDD:238020
FN3 1057..1151 CDD:238020
FN3 1156..1251 CDD:238020
FN3 1258..1356 CDD:238020
FN3 1361..1453 CDD:238020
FN3 1464..1560 CDD:238020
FN3 1572..1664 CDD:238020
FN3 1679..1764 CDD:238020
FN3 1774..1858 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.