DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and lad-2

DIOPT Version :10

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001023496.1 Gene:lad-2 / 177078 WormBaseID:WBGene00002243 Length:1187 Species:Caenorhabditis elegans


Alignment Length:374 Identity:89/374 - (23%)
Similarity:148/374 - (39%) Gaps:70/374 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ALNIFPSRFTNRRIMFLIYMTNLVTHVMMDEPRFAQPIPNVTVAVGRDANLPCVVEH-LGGYKVA 76
            |.|||.:..:|:..:.|..:.:.        |:  :.:..:.|..|....|.|.... ....|:.
 Worm   106 ASNIFGTALSNKMHLRLGSLEHF--------PK--RDVKLLRVKEGESLTLNCTPPRGTPDPKIV 160

  Fly    77 WIH---IDRQMILTIH-RHVISRIPRYSITYTDNTWLLHVNQAHQDDRG---YYMCQVNTNPMI- 133
            |::   .|..:|.||. ||:.          .||...||.:.....|..   .|.|.. |:|:: 
 Worm   161 WLYRSLDDSSVIETIRSRHIT----------VDNEGHLHFSSVELSDGKATLVYECAA-TSPVLR 214

  Fly   134 ---SQVGYLQVVVPPN------ILDIESTPSSVAVRENQNINMTCRADGFPAPKIIWRREDGEEI 189
               .....:|:.:.|:      :..:..:||.|.||....:.:.|...|.|.|.|.|.:.|| |:
 Worm   215 GEYRSGDRIQLDIEPSQDKSHPVKKMSVSPSEVTVRAGGQLKLQCIFGGRPLPTIFWSKIDG-EL 278

  Fly   190 AVEKKKKVLVYDADV---LPLTKVSRNEMGAYLCIATNGVPPSVSKRIILDV--EFSPMIWVPNQ 249
            ...:.|.:..:::|.   |.:..|..::.|||.|...:.| .:|:.|::...  ||.|    |..
 Worm   279 PKSRIKDLTSHESDFGRSLIVENVHPDDAGAYECRGRHLV-HTVNVRVMAAPFWEFDP----PRD 338

  Fly   250 LVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKKYKTDYTENSYRAHMK----LTIRNLQY 310
             :..|..:...::|.....|..||.|..|.       |:..:..|:|.|..:.    |.:|||.:
 Worm   339 -ISLPEESTGELECLAGGQPTPIITWSMNG-------KFLHELAEDSRRVLLDHGRILRVRNLNH 395

  Fly   311 G-DFGNYRCISKNSLGETEGSIRVY---EIPLPSTPS----KQVTHTTV 351
            . |.|.|:|.:.|.||....:..|:   ..|....|:    |.|.|:||
 Worm   396 DLDTGVYQCNASNPLGYVFANAFVHVRAHAPFFRMPAARHWKVVLHSTV 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 22/103 (21%)
Ig strand B 61..65 CDD:409353 1/3 (33%)
Ig strand C 74..78 CDD:409353 1/3 (33%)
Ig strand E 105..112 CDD:409353 3/6 (50%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 0/2 (0%)
Ig 145..238 CDD:472250 26/101 (26%)
Ig strand B 165..169 CDD:409353 0/3 (0%)
Ig strand C 178..182 CDD:409353 1/3 (33%)
Ig strand E 203..207 CDD:409353 2/6 (33%)
Ig strand F 217..222 CDD:409353 3/4 (75%)
Ig strand G 231..234 CDD:409353 0/2 (0%)
Ig 242..333 CDD:472250 24/95 (25%)
Ig strand B 259..263 CDD:409353 0/3 (0%)
Ig strand C 272..276 CDD:409353 2/3 (67%)
Ig strand E 295..305 CDD:409353 3/13 (23%)
Ig strand F 315..320 CDD:409353 2/4 (50%)
Ig strand G 328..331 CDD:409353 0/2 (0%)
lad-2NP_001023496.1 Ig 25..121 CDD:472250 5/14 (36%)
Ig strand B 49..53 CDD:409353
Ig strand C 61..65 CDD:409353
Ig strand E 87..91 CDD:409353
Ig strand F 101..106 CDD:409353 89/374 (24%)
Ig strand G 115..118 CDD:409353 1/2 (50%)
Ig 133..216 CDD:472250 21/93 (23%)
Ig strand B 144..148 CDD:409353 1/3 (33%)
Ig strand C 158..162 CDD:409353 1/3 (33%)
Ig strand E 186..190 CDD:409353 1/3 (33%)
Ig strand F 203..208 CDD:409353 2/4 (50%)
Ig 243..325 CDD:472250 24/83 (29%)
Ig strand B 255..259 CDD:409353 0/3 (0%)
Ig strand C 268..272 CDD:409353 1/3 (33%)
Ig strand E 295..299 CDD:409353 1/3 (33%)
Ig strand F 309..314 CDD:409353 3/4 (75%)
Ig4_L1-NrCAM_like 330..422 CDD:409367 27/103 (26%)
Ig strand B 347..351 CDD:409367 0/3 (0%)
Ig strand C 360..364 CDD:409367 2/3 (67%)
Ig strand E 386..390 CDD:409367 1/3 (33%)
Ig strand F 401..406 CDD:409367 2/4 (50%)
Ig strand G 414..417 CDD:409367 0/2 (0%)
IG_like 438..515 CDD:214653 4/7 (57%)
Ig strand B 444..448 CDD:409353 1/1 (100%)
Ig strand C 457..461 CDD:409353
Ig strand E 482..485 CDD:409353
Ig strand F 495..500 CDD:409353
Ig strand G 508..511 CDD:409353
Ig 527..593 CDD:472250
Ig strand B 538..542 CDD:409353
Ig strand C 551..557 CDD:409353
Ig strand E 574..578 CDD:409353
Ig strand F 588..593 CDD:409353
FN3 610..697 CDD:238020
FN3 <666..1095 CDD:442628
fn3 823..909 CDD:394996
FN3 921..1010 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.