DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and rig-5

DIOPT Version :10

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001251131.1 Gene:rig-5 / 172791 WormBaseID:WBGene00004372 Length:482 Species:Caenorhabditis elegans


Alignment Length:326 Identity:112/326 - (34%)
Similarity:163/326 - (50%) Gaps:23/326 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PRFAQPIPNVTVA-VGRDANLPCVVEHLGGYKVAWIHIDR-QMILTIHRHVISRIPRYS----IT 102
            |...||..:..|| :|:|.:..|:|..||.:.||::..|. ..:|:....|..|..:|.    |.
 Worm    84 PTIQQPSMSSAVALLGQDVDFTCIVNDLGSHMVAFVKADSPPRLLSFDEKVFRRRNKYELKPRIG 148

  Fly   103 YTDNTWLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINM 167
            ...|.|:|.:....:.|||.|.||:||.|:....|.|.|.|||.:  ..|||::|.|||..|:::
 Worm   149 DLHNEWVLTIKNVQESDRGNYSCQINTEPITLSTGELDVKVPPVV--SRSTPAAVEVREGNNVSL 211

  Fly   168 TCRADGFPAPKIIWRREDGEEIAVEKKK--KVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSV 230
            ||:|||.|.|.:||||:|.:.|......  ...|:...||.||||||..|..|||:|:||:||..
 Worm   212 TCKADGNPTPTVIWRRQDRQIIRYNGATGFGASVFHGPVLHLTKVSRKHMSEYLCVASNGIPPDE 276

  Fly   231 SKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKKYKTDYT-E 294
            |..:.|.|.|.|::...::.|.|..|:...:.|.|||.|:..:.|..:...|..|......:| .
 Worm   277 SWTVKLLVTFPPLVQAQSETVQASVGSMARMVCTTEAWPRPEMGWEKDGEPVYESNNVAMTHTVS 341

  Fly   295 NSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPSTPSKQVTHTTVESRENNII 359
            ..|.:...|.|||:|...||.|||::||..|.....:.:          .|::|.  ....:|:|
 Worm   342 GQYHSVHILEIRNVQSSHFGVYRCVAKNDNGIHHSQVTL----------NQISHN--HFTNSNLI 394

  Fly   360 P 360
            |
 Worm   395 P 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 31/97 (32%)
Ig strand B 61..65 CDD:409353 0/3 (0%)
Ig strand C 74..78 CDD:409353 2/3 (67%)
Ig strand E 105..112 CDD:409353 3/6 (50%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 0/2 (0%)
Ig 145..238 CDD:472250 42/94 (45%)
Ig strand B 165..169 CDD:409353 0/3 (0%)
Ig strand C 178..182 CDD:409353 1/3 (33%)
Ig strand E 203..207 CDD:409353 2/3 (67%)
Ig strand F 217..222 CDD:409353 3/4 (75%)
Ig strand G 231..234 CDD:409353 1/2 (50%)
Ig 242..333 CDD:472250 27/91 (30%)
Ig strand B 259..263 CDD:409353 0/3 (0%)
Ig strand C 272..276 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 2/9 (22%)
Ig strand F 315..320 CDD:409353 3/4 (75%)
Ig strand G 328..331 CDD:409353 0/2 (0%)
rig-5NP_001251131.1 IG_like 92..189 CDD:214653 31/96 (32%)
Ig strand B 102..106 CDD:409353 0/3 (0%)
Ig strand C 118..122 CDD:409353 0/3 (0%)
Ig strand E 154..158 CDD:409353 2/3 (67%)
Ig strand F 168..173 CDD:409353 2/4 (50%)
Ig_3 190..270 CDD:464046 37/81 (46%)
Ig_3 287..369 CDD:464046 24/81 (30%)

Return to query results.
Submit another query.