DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and LOC1273932

DIOPT Version :10

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_312987.6 Gene:LOC1273932 / 1273932 VectorBaseID:AGAMI1_015034 Length:371 Species:Anopheles gambiae


Alignment Length:104 Identity:25/104 - (24%)
Similarity:45/104 - (43%) Gaps:8/104 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DSEGPWRSSTSMNAISFGFVATAILISMFLIMAIFEHLFRPENSSFDSPHQ-IRQRQRDGSSQFQ 79
            |.|.|:.|::|.| ::...|..|:.......|.....|..|...::.:..: :..|...|   :|
Mosquito   697 DGEEPYFSASSSN-MNMKIVPGAVTFQNIDEMTKKSALNPPGTLAYITEEEALLVRVNKG---WQ 757

  Fly    80 KLADQASMVPVSTVVDVSVVMPGEK--LPSHIALPAPLP 116
            .:| ..::||::|....:.|.|..:  |.|...|.:|.|
Mosquito   758 YIA-LGTLVPIATPAPPTTVAPSMRFDLQSKNLLNSPPP 795

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 16/69 (23%)
Ig strand B 61..65 CDD:409353 0/3 (0%)
Ig strand C 74..78 CDD:409353 1/3 (33%)
Ig strand E 105..112 CDD:409353 2/6 (33%)
Ig strand F 122..127 CDD:409353
Ig strand G 134..137 CDD:409353
Ig 145..238 CDD:472250
Ig strand B 165..169 CDD:409353
Ig strand C 178..182 CDD:409353
Ig strand E 203..207 CDD:409353
Ig strand F 217..222 CDD:409353
Ig strand G 231..234 CDD:409353
Ig 242..333 CDD:472250
Ig strand B 259..263 CDD:409353
Ig strand C 272..276 CDD:409353
Ig strand E 295..305 CDD:409353
Ig strand F 315..320 CDD:409353
Ig strand G 328..331 CDD:409353
LOC1273932XP_312987.6 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.