DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and ncam1b

DIOPT Version :10

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_009289824.1 Gene:ncam1b / 114442 ZFINID:ZDB-GENE-010822-2 Length:1054 Species:Danio rerio


Alignment Length:436 Identity:92/436 - (21%)
Similarity:154/436 - (35%) Gaps:138/436 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 YKVAWIHIDRQMILTIHRHVISRIPRYSITYTDNTWLLHVNQAHQDDRGYYMCQVNTNPMISQVG 137
            ||.|.|..|:.:             |:. |.::|.  |.:....:.|.|.|.|:...... .:|.
Zfish   150 YKGAKIQFDKDV-------------RFK-TLSNNH--LQIRGIRKTDEGVYTCEGRIKAR-GEVD 197

  Fly   138 YLQVVVPPNILDIESTPSSVAVRE---NQNINM------TCRADGFPAPKIIWRR---------- 183
            :..:.|..|:|      .::.:|:   |...:|      .|..||||.|.:.|||          
Zfish   198 FRSIKVVVNVL------PTIRIRQAETNATADMGFSTLLACDPDGFPEPIVTWRRNNAPLESGNK 256

  Fly   184 ----EDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRIILDVEFSPMI 244
                |||.|:.             ||.:||:   :.|.|.|||.|....| .:.:.|.|...|.|
Zfish   257 YSFNEDGSEMT-------------VLDVTKL---DEGDYTCIAKNKAGES-EQELSLKVFVQPKI 304

  Fly   245 WVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKK------YKTDYT---------- 293
            ..............||:.|.....|...|.|.:.:.:....::      |:..:|          
Zfish   305 TYLESQTTTEMDEQVTLTCEATGDPTPTITWSFGTRVFTEGEQEQQKRIYQASWTRPEQHKGPDG 369

  Fly   294 ENSYRAHMK---LTIRNLQYGDFGNYRCISKNSLGETE--------------GSIRVY------- 334
            |...|:..:   ||::..||.|.|.|.|.::|::|||.              ||:.||       
Zfish   370 EVLVRSDARVSSLTLKYPQYTDAGQYLCTARNAIGETVQPVSLEVRYAPKILGSVAVYTWEGNPA 434

  Fly   335 ----------------------EIPLPSTPSKQVTHTTVESRENNIIPSSRND-------TTKSL 370
                                  ::|..:|.:.:: |.|..:....:.|.|::|       |:..:
Zfish   435 NISCEVLAHPSDVSITWLRDGFQLPNANTSNIKI-HNTPSASYLEVNPESQSDFGNYNCTTSNEI 498

  Fly   371 QTDVGYAMKNDLYPGSASSSSSGGSSSAASSSSSM--QTSALPGGV 414
            .|:   :.:..:.|....|:.|.|.....||::.:  :.....|||
Zfish   499 GTE---SREFIMIPADVPSAPSIGEVQPYSSTAQVLFEEPESTGGV 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 14/69 (20%)
Ig strand B 61..65 CDD:409353
Ig strand C 74..78 CDD:409353 2/3 (67%)
Ig strand E 105..112 CDD:409353 2/6 (33%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 0/2 (0%)
Ig 145..238 CDD:472250 30/115 (26%)
Ig strand B 165..169 CDD:409353 1/9 (11%)
Ig strand C 178..182 CDD:409353 0/3 (0%)
Ig strand E 203..207 CDD:409353 2/3 (67%)
Ig strand F 217..222 CDD:409353 2/4 (50%)
Ig strand G 231..234 CDD:409353 0/2 (0%)
Ig 242..333 CDD:472250 26/123 (21%)
Ig strand B 259..263 CDD:409353 2/3 (67%)
Ig strand C 272..276 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 2/12 (17%)
Ig strand F 315..320 CDD:409353 2/4 (50%)
Ig strand G 328..331 CDD:409353 1/16 (6%)
ncam1bXP_009289824.1 Ig 20..113 CDD:472250
Ig strand B 37..41 CDD:409353
Ig strand C 49..53 CDD:409353
Ig strand E 77..81 CDD:409353
Ig strand F 91..96 CDD:409353
Ig strand G 104..107 CDD:409353
Ig 117..186 CDD:472250 12/51 (24%)
Ig strand B 132..136 CDD:409353
Ig strand C 145..149 CDD:409353
Ig strand E 169..173 CDD:409353 2/5 (40%)
Ig strand F 183..188 CDD:409353 2/4 (50%)
Ig strand G 198..201 CDD:409353 0/2 (0%)
Ig 208..301 CDD:472250 30/115 (26%)
Ig strand B 228..232 CDD:409353 0/3 (0%)
Ig strand C 241..245 CDD:409353 0/3 (0%)
Ig strand E 264..268 CDD:409353 1/16 (6%)
Ig strand F 278..283 CDD:409353 2/4 (50%)
Ig strand G 291..294 CDD:409353 0/2 (0%)
Ig 300..414 CDD:472250 24/113 (21%)
Ig strand B 319..323 CDD:409353 2/3 (67%)
Ig strand C 332..336 CDD:409353 1/3 (33%)
Ig strand E 380..384 CDD:409353 1/3 (33%)
Ig strand F 394..399 CDD:409353 2/4 (50%)
Ig strand G 407..410 CDD:409353 0/2 (0%)
IG_like 426..505 CDD:214653 11/82 (13%)
Ig strand B 434..438 CDD:409353 0/3 (0%)
Ig strand C 448..452 CDD:409353 0/3 (0%)
Ig strand E 475..479 CDD:409353 0/3 (0%)
Ig strand F 489..494 CDD:409353 0/4 (0%)
FN3 513..606 CDD:238020 8/29 (28%)
fn3 642..712 CDD:394996
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.