DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and iglon5

DIOPT Version :10

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_002938252.1 Gene:iglon5 / 100488314 XenbaseID:XB-GENE-945713 Length:333 Species:Xenopus tropicalis


Alignment Length:347 Identity:103/347 - (29%)
Similarity:150/347 - (43%) Gaps:77/347 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IYMTNLVTHVMMDEPRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHR---H 91
            |.|...|..|...|  |..|..|.||:.|.:|.|.|:::. ...:|||  ::|..||...:   .
 Frog    15 IVMLAQVLFVQCTE--FVPPADNYTVSQGDNATLSCLIDD-KVTRVAW--LNRSNILYAGKDKWS 74

  Fly    92 VISRI-------PRYSITYTDNTWLLHVNQAHQDDRGYYMC--QVNTNPMISQVGYLQVVVPPNI 147
            :.||:       ..|||..|      ||:.|   |.|.|.|  |....|..||| ||.|.||..|
 Frog    75 IDSRVQLLTNTKSEYSIVIT------HVDVA---DEGLYTCSFQTEDKPHTSQV-YLIVQVPAKI 129

  Fly   148 LDIESTPSSVAVRENQNINMTCRADGFPAPKIIWRR-EDGEEIAVEKKKKVLVYDADVLPLTKVS 211
            ::|.   |||.|.|..|:|:.|.|.|.|.|.|.|:: .:|           ...:.::|.:|:::
 Frog   130 VNIS---SSVTVNEGSNVNLQCLAVGKPEPTITWQQLSEG-----------FSSEGELLEITEIN 180

  Fly   212 RNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIW-VPNQLVGAPSGTDVTIDCHTEAHPKAIIYW 275
            |.:.|.|.|:.:|||....:|::.:.|.:.|.|. |.|  ..:|.|...|:.|...|.|.|...|
 Frog   181 RQQAGDYECVTSNGVSVPDTKKVQITVNYPPYITDVKN--AQSPVGRPATLRCKAMAVPPAEFEW 243

  Fly   276 VYNSVMVLPSKKYKTD-------------YTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGET 327
                        ||.:             .||:|:..   :...|:....:|||.|::.|.||..
 Frog   244 ------------YKDEKRRLISGTEGLSIKTESSWSV---IVFSNVTSRHYGNYTCLASNKLGSF 293

  Fly   328 EGSIRVYEIPLPSTPSKQ-VTH 348
            ..|:|:.:   |..|..| .||
 Frog   294 NSSLRLLK---PGDPLNQGATH 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 34/103 (33%)
Ig strand B 61..65 CDD:409353 2/3 (67%)
Ig strand C 74..78 CDD:409353 2/3 (67%)
Ig strand E 105..112 CDD:409353 0/6 (0%)
Ig strand F 122..127 CDD:409353 2/6 (33%)
Ig strand G 134..137 CDD:409353 2/2 (100%)
Ig 145..238 CDD:472250 27/93 (29%)
Ig strand B 165..169 CDD:409353 1/3 (33%)
Ig strand C 178..182 CDD:409353 1/3 (33%)
Ig strand E 203..207 CDD:409353 1/3 (33%)
Ig strand F 217..222 CDD:409353 2/4 (50%)
Ig strand G 231..234 CDD:409353 1/2 (50%)
Ig 242..333 CDD:472250 26/104 (25%)
Ig strand B 259..263 CDD:409353 1/3 (33%)
Ig strand C 272..276 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 1/9 (11%)
Ig strand F 315..320 CDD:409353 3/4 (75%)
Ig strand G 328..331 CDD:409353 0/2 (0%)
iglon5XP_002938252.1 Ig 31..123 CDD:472250 34/104 (33%)
Ig strand B 44..48 CDD:409353 2/3 (67%)
Ig strand C 56..60 CDD:409353 3/5 (60%)
Ig strand E 89..93 CDD:409353 3/3 (100%)
Ig strand F 103..108 CDD:409353 2/4 (50%)
Ig strand G 116..119 CDD:409353 1/2 (50%)
Ig 122..207 CDD:472250 30/98 (31%)
Ig strand B 144..148 CDD:409353 1/3 (33%)
Ig strand C 157..160 CDD:409353 1/2 (50%)
Ig strand E 172..176 CDD:409353 1/3 (33%)
Ig strand F 186..191 CDD:409353 2/4 (50%)
Ig strand G 200..203 CDD:409353 1/2 (50%)
Ig_3 210..288 CDD:464046 22/94 (23%)

Return to query results.
Submit another query.