| Sequence 1: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_002660995.5 | Gene: | si:ch211-215e19.3 / 100332384 | ZFINID: | ZDB-GENE-060503-685 | Length: | 280 | Species: | Danio rerio |
| Alignment Length: | 224 | Identity: | 42/224 - (18%) |
|---|---|---|---|
| Similarity: | 80/224 - (35%) | Gaps: | 38/224 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 244 IWVPNQLVGAPSGTDVTIDC-HTEAHPKAIIYWVYNSVMVLPS-----KKYKTDYTENSYRAHMK 302
Fly 303 LTI--RNLQYGDFGNYRCISK-NSLGETEGSIRVYEIPLPSTPSKQVTHTTVESRENNIIPSSRN 364
Fly 365 DTTKSLQTDVGYAMKN-----------DLYPGSASSSSSGGSSSAASSSSSMQTSALPGGVAGNS 418
Fly 419 LSSMG----SKGSLAIGKSTFYTERPPNE 443 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | |
| Ig | 145..238 | CDD:416386 | |||
| Ig strand A | 145..149 | CDD:409353 | |||
| Ig strand A' | 154..159 | CDD:409353 | |||
| Ig strand B | 165..172 | CDD:409353 | |||
| Ig strand C | 178..183 | CDD:409353 | |||
| Ig strand C' | 185..187 | CDD:409353 | |||
| Ig strand D | 195..199 | CDD:409353 | |||
| Ig strand E | 203..209 | CDD:409353 | |||
| Ig strand F | 216..223 | CDD:409353 | |||
| Ig strand G | 230..238 | CDD:409353 | |||
| Ig | 242..333 | CDD:416386 | 19/97 (20%) | ||
| Ig strand A' | 250..253 | CDD:409353 | 0/2 (0%) | ||
| Ig strand B | 259..266 | CDD:409353 | 2/7 (29%) | ||
| Ig strand C | 272..277 | CDD:409353 | 1/4 (25%) | ||
| Ig strand C' | 281..283 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 289..293 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 295..305 | CDD:409353 | 2/9 (22%) | ||
| Ig strand F | 314..322 | CDD:409353 | 2/8 (25%) | ||
| Ig strand G | 325..334 | CDD:409353 | 1/8 (13%) | ||
| si:ch211-215e19.3 | XP_002660995.5 | Ig | 51..122 | CDD:325142 | 14/70 (20%) |
| Ig | 149..235 | CDD:325142 | 17/98 (17%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 40 | 1.000 | Domainoid score | I12510 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||