DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and chl1b

DIOPT Version :10

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_017212175.2 Gene:chl1b / 100318566 ZFINID:ZDB-GENE-091105-1 Length:1294 Species:Danio rerio


Alignment Length:285 Identity:70/285 - (24%)
Similarity:109/285 - (38%) Gaps:42/285 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 GRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITYTDNTWLLHVNQAHQDDRGY 122
            |.|..|.|:.|.....||.|:.|.           .:::|. .:....:..||.|...:::|.|.
Zfish   276 GEDLQLECIAEGFPTPKVEWVKIG-----------FNKLPE-RVVVESHGKLLTVEMVNEEDEGK 328

  Fly   123 YMCQVNTNPMISQVGYLQVVV--PPNILDIESTPSSVAVRENQNINMTCRADGFPAPKIIWRRED 185
            |||:.. ||....|.:..|.|  ||   :.|..|.|..|....::.:.|...|.|.|.:.| |.:
Zfish   329 YMCRAK-NPHGEVVHHFHVTV
EEPP---EFEIEPQSQLVTIGADVLIKCVVKGNPQPTVGW-RVN 388

  Fly   186 G---EEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVP 247
            |   .|:....:|   :.....:.:...:......|.|.|||.....::...|:.:...|:|...
Zfish   389 GRPLNEVPTSNRK---ILKDGTISIHNANPENSAVYQCEATNKHGTILANANI
MIMNIQPLILTE 450

  Fly   248 NQL-VGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKKYKTDYTENS-YRAHM--KLTIRNL 308
            |.| ..|..|..|.:.|...:.|.:.|.|         ||....:..|.. :..|.  .|.|.|:
Zfish   451 NNLQYMAVEGKSVVMHCKVFSSPASSITW---------SKADSANAVEGERFTVHQNGSLEIHNV 506

  Fly   309 QYGDFGNYRCISKNSLGETEGSIRV 333
            ...|.|.|.|.::|    |||.:.:
Zfish   507 MKEDMGEYSCFAQN----TEGKVAI 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 22/84 (26%)
Ig strand B 61..65 CDD:409353 1/3 (33%)
Ig strand C 74..78 CDD:409353 2/3 (67%)
Ig strand E 105..112 CDD:409353 2/6 (33%)
Ig strand F 122..127 CDD:409353 3/4 (75%)
Ig strand G 134..137 CDD:409353 0/2 (0%)
Ig 145..238 CDD:472250 20/95 (21%)
Ig strand B 165..169 CDD:409353 0/3 (0%)
Ig strand C 178..182 CDD:409353 0/3 (0%)
Ig strand E 203..207 CDD:409353 0/3 (0%)
Ig strand F 217..222 CDD:409353 2/4 (50%)
Ig strand G 231..234 CDD:409353 0/2 (0%)
Ig 242..333 CDD:472250 26/94 (28%)
Ig strand B 259..263 CDD:409353 1/3 (33%)
Ig strand C 272..276 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 2/12 (17%)
Ig strand F 315..320 CDD:409353 2/4 (50%)
Ig strand G 328..331 CDD:409353 2/2 (100%)
chl1bXP_017212175.2 Ig 42..135 CDD:472250
Ig strand B 61..65 CDD:409396
Ig strand C 74..78 CDD:409396
Ig strand E 99..103 CDD:409396
Ig strand F 115..120 CDD:409396
Ig strand G 129..132 CDD:409396
Ig 144..234 CDD:472250
Ig strand B 158..162 CDD:409432
Ig strand C 172..176 CDD:409432
Ig strand E 195..199 CDD:409432
Ig strand F 210..215 CDD:409432
Ig strand G 226..229 CDD:409432
Ig 267..348 CDD:472250 22/84 (26%)
Ig strand B 279..283 CDD:409394 1/3 (33%)
Ig strand C 292..296 CDD:409394 2/3 (67%)
Ig strand E 314..318 CDD:409394 2/3 (67%)
Ig strand F 328..333 CDD:409394 3/4 (75%)
Ig strand G 341..344 CDD:409394 1/2 (50%)
Ig 359..438 CDD:472250 16/82 (20%)
Ig strand B 369..373 CDD:409367 0/3 (0%)
Ig strand C 382..386 CDD:409367 1/4 (25%)
Ig strand E 406..410 CDD:409367 0/3 (0%)
Ig strand F 420..425 CDD:409367 2/4 (50%)
Ig strand G 433..436 CDD:409367 0/2 (0%)
Ig 447..533 CDD:472250 25/94 (27%)
Ig strand B 463..467 CDD:409544 1/3 (33%)
Ig strand C 476..480 CDD:409544 2/12 (17%)
Ig strand E 499..503 CDD:409544 1/3 (33%)
Ig strand F 513..518 CDD:409544 2/4 (50%)
Ig strand G 526..529 CDD:409544 0/2 (0%)
Ig 535..635 CDD:472250
Ig strand B 554..558 CDD:409359
Ig strand C 571..575 CDD:409359
Ig strand E 594..598 CDD:409359
Ig strand F 608..613 CDD:409359
Ig strand G 621..624 CDD:409359
FN3 632..722 CDD:238020
FN3 <702..1101 CDD:442628
FN3 1070..1142 CDD:214495
Bravo_FIGEY 1196..1279 CDD:464016
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.