DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and kirrel1b

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_017212964.1 Gene:kirrel1b / 100170816 ZFINID:ZDB-GENE-070912-173 Length:801 Species:Danio rerio


Alignment Length:545 Identity:102/545 - (18%)
Similarity:181/545 - (33%) Gaps:182/545 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MFLIYMTNLVTHVMMDEPRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRH 91
            ::::.:..:..|.:...|||:|...:.:|.:|....|.|||.:..|. |.|  ....:.|.|...
Zfish     8 LWIVTLAIISVHRVFSGPRFSQEPADQSVVIGERVVLSCVVFNYTGI-VQW--TKDGLALGIGED 69

  Fly    92 VISRIPRYSITYTDNT--WLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILDIESTP 154
             :...|||.:....:.  :.|.:..|...|...|.||.....:.|:...|.|::||:...||.:|
Zfish    70 -LRAWPRYRVLRIMDVGQYNLEITSADLTDDSLYECQATEAALRSRRAKLTVLIPPDGPVIEGSP 133

  Fly   155 SSVAVRENQNINMTCRADGF-PAPKIIWRREDG---------EEIAVEKKKKVLVYDADVLPL-T 208
             .:.:....:.|:||.:.|. |...|.|.: ||         .|:..::|:.......::.|: |
Zfish   134 -EILLTAGTSFNLTCVSRGAKPMSTIEWYK-DGIIVEGAHTSTEVLSDRKRVTTKSFLEIQPMDT 196

  Fly   209 KVSRNEMGAYLCIATNGVPP--------------------------------------------- 228
            ...||    :.|:|:|...|                                             
Zfish   197 DTGRN----FTCVASNLAAPLGKRSTVTLNIHHPPTVILSIEPRSVLEGERVKFTCQATANPPIM 257

  Fly   229 -----------------------------------------SVSKRIILDVEFSPMIWVPNQLVG 252
                                                     |.:..|::||.|.|::.|..:.|.
Zfish   258 GYRWAKGGVILDGARESVFETTADHSFFTEPVSCLVFNAVGSTNVSILVDVHFGPILVVEPRPVT 322

  Fly   253 APSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKKYKTDYTENSYRAHMKLTIRNLQYGDFGNYR 317
            ....:|||::|....:|...:.|         :||..:....||    .:|.::::...|.|.|.
Zfish   323 VDVDSDVTLNCKWSGNPPLTLTW---------TKKGSSMVLSNS----NQLFLKSVSQADAGQYV 374

  Fly   318 C---ISKNSLGETE------------------------GSIRVYEIPLPSTPSKQV--------- 346
            |   :.:..:||||                        |.|:.|....| .|.|.|         
Zfish   375 CKAIVPRIGVGETEVTLTVNGPPIISSEPIQYAVRGEKGEIKCYIASTP-PPDKIVWAWKENVWE 438

  Fly   347 --------THTTVESRENNIIPSSRNDTTKSLQTDVGYAMKNDL---YPGSASSSSSGGS----- 395
                    .:|..:||     |:::.....|..| :...|:.|.   |..:|.::...|:     
Zfish   439 KERGTLLERYTVEQSR-----PATQGGAVLSTLT-INNVMEADFQSTYNCTAWNAFGPGTMIITL 497

  Fly   396 -SSAASSSSSMQTSALPGGVAGNSL 419
             .:..:|...:....:.||..|:|:
Zfish   498 EETDIASEDIVPVGVIAGGSVGSSI 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 23/93 (25%)
Ig 145..238 CDD:416386 25/189 (13%)
Ig strand A 145..149 CDD:409353 1/3 (33%)
Ig strand A' 154..159 CDD:409353 1/4 (25%)
Ig strand B 165..172 CDD:409353 3/6 (50%)
Ig strand C 178..183 CDD:409353 2/4 (50%)
Ig strand C' 185..187 CDD:409353 2/10 (20%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 1/6 (17%)
Ig strand F 216..223 CDD:409353 1/6 (17%)
Ig strand G 230..238 CDD:409353 1/7 (14%)
Ig 242..333 CDD:416386 24/117 (21%)
Ig strand A' 250..253 CDD:409353 1/2 (50%)
Ig strand B 259..266 CDD:409353 3/6 (50%)
Ig strand C 272..277 CDD:409353 1/4 (25%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 3/9 (33%)
Ig strand F 314..322 CDD:409353 3/10 (30%)
Ig strand G 325..334 CDD:409353 6/32 (19%)
kirrel1bXP_017212964.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.