| Sequence 1: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_009305418.1 | Gene: | lrit3b / 100144406 | ZFINID: | ZDB-GENE-070424-130 | Length: | 487 | Species: | Danio rerio |
| Alignment Length: | 332 | Identity: | 65/332 - (19%) |
|---|---|---|---|
| Similarity: | 107/332 - (32%) | Gaps: | 117/332 - (35%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 82 RQMILTIHRHVISRIP----RY--SITYTDNT--------------WLLHVNQAHQDDRGYYMCQ 126
Fly 127 VNTNPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRADGFPAPKIIWRREDGEEIAV 191
Fly 192 EKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRIILDVEFS----PMIWVPNQLVG 252
Fly 253 APSGTDVTIDCHTEAHPKAIIYWV-------YN-----------SVMVLPSKKYKTDYTENSYRA 299
Fly 300 HMK---LTIRNLQYGDFGNYRCISKNSLGETEG--SIRVYEIPLPSTPSK--QVTHTTVESRENN 357
Fly 358 IIPSSRN 364 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | 17/80 (21%) |
| Ig | 145..238 | CDD:416386 | 13/92 (14%) | ||
| Ig strand A | 145..149 | CDD:409353 | 0/3 (0%) | ||
| Ig strand A' | 154..159 | CDD:409353 | 2/4 (50%) | ||
| Ig strand B | 165..172 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 178..183 | CDD:409353 | 0/4 (0%) | ||
| Ig strand C' | 185..187 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 195..199 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 203..209 | CDD:409353 | 2/5 (40%) | ||
| Ig strand F | 216..223 | CDD:409353 | 0/6 (0%) | ||
| Ig strand G | 230..238 | CDD:409353 | 0/7 (0%) | ||
| Ig | 242..333 | CDD:416386 | 25/113 (22%) | ||
| Ig strand A' | 250..253 | CDD:409353 | 0/2 (0%) | ||
| Ig strand B | 259..266 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 272..277 | CDD:409353 | 1/11 (9%) | ||
| Ig strand C' | 281..283 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 289..293 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 295..305 | CDD:409353 | 2/12 (17%) | ||
| Ig strand F | 314..322 | CDD:409353 | 4/7 (57%) | ||
| Ig strand G | 325..334 | CDD:409353 | 3/10 (30%) | ||
| lrit3b | XP_009305418.1 | LRRNT | 51..92 | CDD:214470 | |
| leucine-rich repeat | 69..89 | CDD:275380 | |||
| LRR_8 | 112..172 | CDD:290566 | 3/10 (30%) | ||
| leucine-rich repeat | 114..137 | CDD:275378 | |||
| leucine-rich repeat | 138..161 | CDD:275378 | 65/332 (20%) | ||
| LRR_8 | 160..214 | CDD:290566 | 13/54 (24%) | ||
| LRR_4 | 160..201 | CDD:289563 | 11/39 (28%) | ||
| leucine-rich repeat | 162..185 | CDD:275378 | 7/22 (32%) | ||
| leucine-rich repeat | 186..199 | CDD:275378 | 3/12 (25%) | ||
| leucine-rich repeat | 215..230 | CDD:275378 | 3/15 (20%) | ||
| Ig | 278..391 | CDD:299845 | 25/114 (22%) | ||
| I-set | 279..391 | CDD:254352 | 25/113 (22%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||