DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and negr1

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_031755650.1 Gene:negr1 / 100127726 XenbaseID:XB-GENE-987949 Length:388 Species:Xenopus tropicalis


Alignment Length:302 Identity:92/302 - (30%)
Similarity:134/302 - (44%) Gaps:32/302 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 IPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSI-TYTDNTWLLHVN 113
            :.|:.|..|..|.|.|.:|. |..|.||  ::|..|:.......|..||.|| |.:...:.|.:.
 Frog    46 VDNLVVRQGETAMLRCFLEE-GASKGAW--LNRSSIIFAGGDKWSVDPRVSIATSSKQEYSLRIQ 107

  Fly   114 QAHQDDRGYYMCQVNT--NPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRADGFPA 176
            :....|.|.|.|.|.|  :|...|| :|.|.|.|.|.||.   |.:.|.|..|:::.|.|.|.|.
 Frog   108 KVDVSDDGPYTCSVQTEHSPRTLQV-HLTVHVSPKIYDIS---SDMTVNEGTNVSLICLATGKPE 168

  Fly   177 PKIIWRREDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVP-PSVSKRIILDVEF 240
            |.|.||     .|:...|:   ......|.:..::|::.|.|.|.|.|.|. |.| |::.:.|.|
 Frog   169 PSISWR-----HISPSAKQ---FGSGQYLDIYGITRDQAGDYECSAENDVSFPDV-KKVKVTVNF 224

  Fly   241 SPMIWVPNQLVGAPSGTDV----TIDCHTEAHPKAIIYWVYNSVMVLPSKKYKTDYTENSYRAHM 301
            :|.|     |...|:|..:    .|.|.|.|.|..:..|......:...::   .....:|....
 Frog   225 APTI-----LEITPTGVSLGRTGLIRCETAAVPAPVFEWYKGEKKLTNGQR---GIRIQNYNTRS 281

  Fly   302 KLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPSTPS 343
            .||:.|:....||||.|::.|.||.:..|:.:.:|..|||.|
 Frog   282 ILTVSNVTEEHFGNYTCVAVNKLGTSNASLPLNQIIEPSTTS 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 31/94 (33%)
Ig 145..238 CDD:416386 29/93 (31%)
Ig strand A 145..149 CDD:409353 2/3 (67%)
Ig strand A' 154..159 CDD:409353 1/4 (25%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 2/4 (50%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 2/7 (29%)
Ig 242..333 CDD:416386 24/94 (26%)
Ig strand A' 250..253 CDD:409353 1/2 (50%)
Ig strand B 259..266 CDD:409353 2/10 (20%)
Ig strand C 272..277 CDD:409353 1/4 (25%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 2/9 (22%)
Ig strand F 314..322 CDD:409353 4/7 (57%)
Ig strand G 325..334 CDD:409353 2/8 (25%)
negr1XP_031755650.1 Ig 44..136 CDD:416386 30/93 (32%)
FR1 44..62 CDD:409353 5/15 (33%)
Ig strand A' 47..53 CDD:409353 2/5 (40%)
Ig strand B 55..63 CDD:409353 3/7 (43%)
CDR1 63..68 CDD:409353 2/5 (40%)
FR2 69..75 CDD:409353 3/7 (43%)
Ig strand C 69..74 CDD:409353 3/6 (50%)
CDR2 76..87 CDD:409353 1/10 (10%)
Ig strand C' 78..82 CDD:409353 1/3 (33%)
Ig strand C' 84..87 CDD:409353 0/2 (0%)
FR3 88..122 CDD:409353 10/33 (30%)
Ig strand D 91..98 CDD:409353 4/6 (67%)
Ig strand E 101..107 CDD:409353 1/5 (20%)
Ig strand F 114..122 CDD:409353 3/7 (43%)
CDR3 123..127 CDD:409353 1/3 (33%)
Ig strand G 127..136 CDD:409353 4/9 (44%)
FR4 129..136 CDD:409353 3/7 (43%)
Ig_3 140..208 CDD:404760 24/78 (31%)
Ig strand A' 146..151 CDD:409353 1/7 (14%)
Ig strand B 157..164 CDD:409353 1/6 (17%)
Ig strand C 170..175 CDD:409353 3/9 (33%)
Ig strand C' 177..179 CDD:409353 0/1 (0%)
Ig strand E 187..193 CDD:409353 1/5 (20%)
Ig strand F 200..207 CDD:409353 3/6 (50%)
Ig strand G 214..222 CDD:409353 2/8 (25%)
Ig_3 226..302 CDD:404760 20/83 (24%)
putative Ig strand A 226..232 CDD:409353 3/10 (30%)
Ig strand B 242..246 CDD:409353 1/3 (33%)
Ig strand C 255..259 CDD:409353 0/3 (0%)
Ig strand E 281..285 CDD:409353 1/3 (33%)
Ig strand F 295..300 CDD:409353 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10578
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I4412
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.