Sequence 1: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_031755650.1 | Gene: | negr1 / 100127726 | XenbaseID: | XB-GENE-987949 | Length: | 388 | Species: | Xenopus tropicalis |
Alignment Length: | 302 | Identity: | 92/302 - (30%) |
---|---|---|---|
Similarity: | 134/302 - (44%) | Gaps: | 32/302 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 50 IPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSI-TYTDNTWLLHVN 113
Fly 114 QAHQDDRGYYMCQVNT--NPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRADGFPA 176
Fly 177 PKIIWRREDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVP-PSVSKRIILDVEF 240
Fly 241 SPMIWVPNQLVGAPSGTDV----TIDCHTEAHPKAIIYWVYNSVMVLPSKKYKTDYTENSYRAHM 301
Fly 302 KLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPSTPS 343 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | 31/94 (33%) |
Ig | 145..238 | CDD:416386 | 29/93 (31%) | ||
Ig strand A | 145..149 | CDD:409353 | 2/3 (67%) | ||
Ig strand A' | 154..159 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 165..172 | CDD:409353 | 1/6 (17%) | ||
Ig strand C | 178..183 | CDD:409353 | 2/4 (50%) | ||
Ig strand C' | 185..187 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 195..199 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 203..209 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 216..223 | CDD:409353 | 3/6 (50%) | ||
Ig strand G | 230..238 | CDD:409353 | 2/7 (29%) | ||
Ig | 242..333 | CDD:416386 | 24/94 (26%) | ||
Ig strand A' | 250..253 | CDD:409353 | 1/2 (50%) | ||
Ig strand B | 259..266 | CDD:409353 | 2/10 (20%) | ||
Ig strand C | 272..277 | CDD:409353 | 1/4 (25%) | ||
Ig strand C' | 281..283 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 289..293 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 295..305 | CDD:409353 | 2/9 (22%) | ||
Ig strand F | 314..322 | CDD:409353 | 4/7 (57%) | ||
Ig strand G | 325..334 | CDD:409353 | 2/8 (25%) | ||
negr1 | XP_031755650.1 | Ig | 44..136 | CDD:416386 | 30/93 (32%) |
FR1 | 44..62 | CDD:409353 | 5/15 (33%) | ||
Ig strand A' | 47..53 | CDD:409353 | 2/5 (40%) | ||
Ig strand B | 55..63 | CDD:409353 | 3/7 (43%) | ||
CDR1 | 63..68 | CDD:409353 | 2/5 (40%) | ||
FR2 | 69..75 | CDD:409353 | 3/7 (43%) | ||
Ig strand C | 69..74 | CDD:409353 | 3/6 (50%) | ||
CDR2 | 76..87 | CDD:409353 | 1/10 (10%) | ||
Ig strand C' | 78..82 | CDD:409353 | 1/3 (33%) | ||
Ig strand C' | 84..87 | CDD:409353 | 0/2 (0%) | ||
FR3 | 88..122 | CDD:409353 | 10/33 (30%) | ||
Ig strand D | 91..98 | CDD:409353 | 4/6 (67%) | ||
Ig strand E | 101..107 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 114..122 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 123..127 | CDD:409353 | 1/3 (33%) | ||
Ig strand G | 127..136 | CDD:409353 | 4/9 (44%) | ||
FR4 | 129..136 | CDD:409353 | 3/7 (43%) | ||
Ig_3 | 140..208 | CDD:404760 | 24/78 (31%) | ||
Ig strand A' | 146..151 | CDD:409353 | 1/7 (14%) | ||
Ig strand B | 157..164 | CDD:409353 | 1/6 (17%) | ||
Ig strand C | 170..175 | CDD:409353 | 3/9 (33%) | ||
Ig strand C' | 177..179 | CDD:409353 | 0/1 (0%) | ||
Ig strand E | 187..193 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 200..207 | CDD:409353 | 3/6 (50%) | ||
Ig strand G | 214..222 | CDD:409353 | 2/8 (25%) | ||
Ig_3 | 226..302 | CDD:404760 | 20/83 (24%) | ||
putative Ig strand A | 226..232 | CDD:409353 | 3/10 (30%) | ||
Ig strand B | 242..246 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 255..259 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 281..285 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 295..300 | CDD:409353 | 3/4 (75%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 58 | 1.000 | Domainoid score | I10578 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 138 | 1.000 | Inparanoid score | I4412 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000150 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X97 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 5.060 |