| Sequence 1: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031751462.1 | Gene: | lsamp / 100124984 | XenbaseID: | XB-GENE-5759171 | Length: | 368 | Species: | Xenopus tropicalis |
| Alignment Length: | 389 | Identity: | 98/389 - (25%) |
|---|---|---|---|
| Similarity: | 154/389 - (39%) | Gaps: | 71/389 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 26 IMFLIYMTNLVTHVMMDEPRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHR 90
Fly 91 HVISRIPRYS------ITYTDNTWLLHVNQAHQDDRGYYMCQVNT--NPMISQVGYLQVVVPPNI 147
Fly 148 LDIESTPSSVAVRENQNINMTCRADGFPAPKIIWR-----------RE-DGEEIAVEKKKKVLVY 200
Fly 201 DADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHT 265
Fly 266 EAHPKAIIYWVYNSVMVLPSKKYKTDYTENSYRAHMKLTIR-----------NLQYGDFGNYRCI 319
Fly 320 SKNSLGETEGSIRVYEIPLPSTPSKQVTHTTVESRENNIIPSSRNDTTKSLQTDVGYAMKNDLY 383 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | 30/99 (30%) |
| Ig | 145..238 | CDD:416386 | 27/104 (26%) | ||
| Ig strand A | 145..149 | CDD:409353 | 2/3 (67%) | ||
| Ig strand A' | 154..159 | CDD:409353 | 0/4 (0%) | ||
| Ig strand B | 165..172 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C | 178..183 | CDD:409353 | 3/15 (20%) | ||
| Ig strand C' | 185..187 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 195..199 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 203..209 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 216..223 | CDD:409353 | 3/6 (50%) | ||
| Ig strand G | 230..238 | CDD:409353 | 1/7 (14%) | ||
| Ig | 242..333 | CDD:416386 | 24/101 (24%) | ||
| Ig strand A' | 250..253 | CDD:409353 | 0/2 (0%) | ||
| Ig strand B | 259..266 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C | 272..277 | CDD:409353 | 1/4 (25%) | ||
| Ig strand C' | 281..283 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 289..293 | CDD:409353 | 2/3 (67%) | ||
| Ig strand E | 295..305 | CDD:409353 | 1/9 (11%) | ||
| Ig strand F | 314..322 | CDD:409353 | 4/7 (57%) | ||
| Ig strand G | 325..334 | CDD:409353 | 3/8 (38%) | ||
| lsamp | XP_031751462.1 | Ig | 38..128 | CDD:416386 | 29/98 (30%) |
| FR1 | 38..54 | CDD:409353 | 6/15 (40%) | ||
| Ig strand A' | 39..45 | CDD:409353 | 3/5 (60%) | ||
| Ig strand B | 47..55 | CDD:409353 | 3/7 (43%) | ||
| CDR1 | 55..59 | CDD:409353 | 2/3 (67%) | ||
| FR2 | 60..67 | CDD:409353 | 3/9 (33%) | ||
| Ig strand C | 60..66 | CDD:409353 | 3/8 (38%) | ||
| CDR2 | 68..78 | CDD:409353 | 1/9 (11%) | ||
| Ig strand C' | 70..73 | CDD:409353 | 1/2 (50%) | ||
| Ig strand C' | 75..78 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 79..114 | CDD:409353 | 9/39 (23%) | ||
| Ig strand D | 83..90 | CDD:409353 | 1/6 (17%) | ||
| Ig strand E | 93..99 | CDD:409353 | 2/10 (20%) | ||
| Ig strand F | 106..114 | CDD:409353 | 3/7 (43%) | ||
| CDR3 | 115..119 | CDD:409353 | 1/3 (33%) | ||
| Ig strand G | 119..128 | CDD:409353 | 4/9 (44%) | ||
| FR4 | 121..128 | CDD:409353 | 4/7 (57%) | ||
| Ig_3 | 131..206 | CDD:404760 | 25/91 (27%) | ||
| Ig strand A' | 138..143 | CDD:409353 | 0/7 (0%) | ||
| Ig strand B | 149..156 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C | 162..167 | CDD:409353 | 2/4 (50%) | ||
| Ig strand C' | 173..175 | CDD:409353 | 0/1 (0%) | ||
| Ig strand E | 185..191 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 198..205 | CDD:409353 | 3/6 (50%) | ||
| Ig strand G | 212..220 | CDD:409353 | 1/7 (14%) | ||
| Ig_3 | 223..302 | CDD:404760 | 19/91 (21%) | ||
| putative Ig strand A | 224..230 | CDD:409353 | 2/6 (33%) | ||
| Ig strand B | 240..244 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 253..257 | CDD:409353 | 1/15 (7%) | ||
| Ig strand E | 281..285 | CDD:409353 | 0/3 (0%) | ||
| Ig strand F | 295..300 | CDD:409353 | 3/4 (75%) | ||
| Ig strand G | 308..311 | CDD:409353 | 0/2 (0%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 58 | 1.000 | Domainoid score | I10578 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 138 | 1.000 | Inparanoid score | I4412 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0000150 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X97 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 5.060 | |||||