DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and igsf9

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001090640.1 Gene:igsf9 / 100036605 XenbaseID:XB-GENE-989817 Length:1423 Species:Xenopus tropicalis


Alignment Length:423 Identity:98/423 - (23%)
Similarity:160/423 - (37%) Gaps:77/423 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VGRDANLPCVVEHLGG-----YKVAWIHIDRQMILTIHRHVISRIPRYSITYTDNTWL-----LH 111
            ||....|.|.:.|...     |.:.|:.....:.:.|...:.|  ||....|...|.:     ||
 Frog    32 VGESTVLGCSLLHQDAGRPPLYVIEWVRFGFMLPIFIKFGLYS--PRVDPQYLGRTRIEEGASLH 94

  Fly   112 VNQAHQDDRGYYMCQV-----NTNPMISQVG---YLQVVVPPNILDIESTPSSVAVRENQNINMT 168
            :.....:|:|:|.|:|     :......|.|   :|.|..||:..  |:.|:.|.||....:.:|
 Frog    95 IESLRSEDQGWYECRVLFLDRHHGEEDFQNGTWVHLTV
NSPPSFR--ETPPTYVEVRVGDTLTLT 157

  Fly   169 CRADGFPAPKIIWRREDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIA-TNGVPPSVSK 232
            |.|.|.|.|.:.|:| ||  :.:|...||...:.. |.:..|.|...|.|.|.| ::....:.:.
 Frog   158 CVAYGNPQPVVTWKR-DG--VTLESGDKVQASNGS-LSIVGVERGNAGVYTCHAFSDEGEVTHTS 218

  Fly   233 RIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIY-WVY--NSVMVL----PSKKYKT 290
            |::  |:..|:|.||.:........|..:.|..||:|..:.| |..  |:|.:|    |..:...
 Frog   219 RVL--V
QGPPIIVVPPENTTVNVSQDAFLTCQAEAYPANLTYTWFQGSNNVFLLNRLQPRVRILV 281

  Fly   291 DYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPSTPSKQVTHTTVESRE 355
            |.:         ..|:.:...|.|.|.||..|.:.::..:.....:..|:..:.....|.:....
 Frog   282 DGS---------FLIQRVTPEDAGKYTCIPSNGMWKSPSASAYLTVLHPAYVTSMPAETYLPIGM 337

  Fly   356 NNII--PSSRNDTTKSLQ-TDVGYAMKNDLYPGSASSSSSGGSSSAASSSSSMQTSALPGGVAGN 417
            ..:|  |...|.....:. |..|:|::.|.|||......                        |:
 Frog   338 RGVIKCPVRANPPLLLVNWTKDGHALELDKYPGWYVDED------------------------GS 378

  Fly   418 SLSSMGSKGSLAIGKSTFYTERPPNEYAASSVA 450
            .:.:.|:..:|.|     ||..|.|.|....|:
 Frog   379 LVIATGNDDALGI-----YTCTPYNSYGTGGVS 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 24/103 (23%)
Ig 145..238 CDD:416386 27/93 (29%)
Ig strand A 145..149 CDD:409353 1/3 (33%)
Ig strand A' 154..159 CDD:409353 2/4 (50%)
Ig strand B 165..172 CDD:409353 2/6 (33%)
Ig strand C 178..183 CDD:409353 1/4 (25%)
Ig strand C' 185..187 CDD:409353 1/1 (100%)
Ig strand D 195..199 CDD:409353 2/3 (67%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 4/7 (57%)
Ig strand G 230..238 CDD:409353 1/7 (14%)
Ig 242..333 CDD:416386 23/97 (24%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 1/6 (17%)
Ig strand C 272..277 CDD:409353 2/5 (40%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 0/9 (0%)
Ig strand F 314..322 CDD:409353 4/7 (57%)
Ig strand G 325..334 CDD:409353 0/8 (0%)
igsf9NP_001090640.1 Ig 25..132 CDD:299845 23/101 (23%)
IG_like 25..110 CDD:214653 19/79 (24%)
I-set 136..222 CDD:254352 27/93 (29%)
IGc2 151..212 CDD:197706 20/64 (31%)
Ig_2 226..318 CDD:290606 23/100 (23%)
I-set 226..318 CDD:254352 23/100 (23%)
IG_like 328..407 CDD:214653 21/108 (19%)
Ig 340..402 CDD:299845 19/90 (21%)
IG_like 431..502 CDD:214653
Ig 439..502 CDD:299845
FN3 507..601 CDD:238020
FN3 624..714 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.