DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34447 and PNLIPRP2

DIOPT Version :9

Sequence 1:NP_001097060.1 Gene:CG34447 / 5740813 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_005387.3 Gene:PNLIPRP2 / 5408 HGNCID:9157 Length:469 Species:Homo sapiens


Alignment Length:302 Identity:94/302 - (31%)
Similarity:139/302 - (46%) Gaps:35/302 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FWLYSNSTRENPILL---DPLDLNPWNFQPPRPLKILIHGYTGDRDFAPNSYIRPVLLDHEDVYV 105
            |.||:|....|..|:   :|..:...|||..|..:.:|||:....:.:..|.:...:.:.|.|..
Human    56 FLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNC 120

  Fly   106 ISIDYGPLVRYPCYIQAVQNLPLVSRCLAQLINNLVDRAIVANDQIHLIGFSLGGQVAGQTANYV 170
            |.:|:....| ..|.|||||:.:|....|.||..|..:...:.:.:|:||.|||...|.:....:
Human   121 ICVDWRHGSR-AMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRL 184

  Fly   171 KRKMKRITGLDPAKPLFILGPDSRRLDKGDADFVDVIHTD------VFGRGYLRAAGHVDFYPNF 229
            ..::.||||||||.|.|...|:..|||..||.||||||||      ..|.|..:..||:||:||.
Human   185 GGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNG 249

  Fly   230 GAKQPGCME-------------ENMQDPSSCNHERAPRFYAESINTTVGFWARQCSGW---LLQL 278
            |.:.|||.:             |.:....||||.|:..:|:.|:....||....|:.:   ....
Human   250 GKEMPGCKKNVLSTITDIDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFLGYPCASYDEFQESK 314

  Fly   279 LTLCPTTGAQALLGYHVSDELRG-------SYFLQTASKSPY 313
            ...||..|...:  .|.:|:.:|       ::||.|.....:
Human   315 CFPCPAEGCPKM--GHYADQFKGKTSAVEQTFFLNTGESGNF 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 94/296 (32%)
PNLIPRP2NP_005387.3 Lipase 18..354 CDD:395099 94/300 (31%)
Required for galactolipase activity. /evidence=ECO:0000269|PubMed:26494624 93..105 3/11 (27%)
Required for galactolipase activity. /evidence=ECO:0000269|PubMed:26494624 257..279 1/21 (5%)
PLAT_PL 357..469 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.