DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34447 and PNLIP

DIOPT Version :9

Sequence 1:NP_001097060.1 Gene:CG34447 / 5740813 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_000927.1 Gene:PNLIP / 5406 HGNCID:9155 Length:465 Species:Homo sapiens


Alignment Length:333 Identity:100/333 - (30%)
Similarity:152/333 - (45%) Gaps:48/333 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NPILGLFDPACQVVRGECPNKNISFWLYSNSTRENP-----ILLDPLDLNPWNFQPPRPLKILIH 79
            :|..|:.:....::.....:.|..|.||:|   |||     :..|...::..||:..|..:.:||
Human    31 SPWSGITERPLHILPWSPKDVNTRFLLYTN---ENPNNFQEVAADSSSISGSNFKTNRKTRFIIH 92

  Fly    80 GY--TGDRDFAPNSYIRPVLLDHEDVYVISIDYGPLVRYPCYIQAVQNLPLVSRCLAQLINNLVD 142
            |:  .|:.::..|  :...|...|.|..|.:|:....| ..|.||.||:.:|...:|..:..|..
Human    93 GFIDKGEENWLAN--VCKNLFKVESVNCICVDWKGGSR-TGYTQASQNIRIVGAEVAYFVEFLQS 154

  Fly   143 RAIVANDQIHLIGFSLGGQVAGQTANYVKRKMKRITGLDPAKPLFILGPDSRRLDKGDADFVDVI 207
            ....:...:|:||.|||...||:........:.||||||||:|.|...|:..|||..||.|||||
Human   155 AFGYSPSNVHVIGHSLGAHAAGEAGRRTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVI 219

  Fly   208 HTD------VFGRGYLRAAGHVDFYPNFGAKQPGCME-------------ENMQDPSSCNHERAP 253
            |||      ..|.|..:..||:||:||.|.:.|||.:             |..:|.::|||.|:.
Human   220 HTDGAPIVPNLGFGMSQVVGHLDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSY 284

  Fly   254 RFYAESINTTVGFWARQCSGWLLQLLTL-----CPTTGAQALLGYHVSDELRG-------SYFLQ 306
            ::|.:||....||....|:.:  .:.|.     ||:.|...:  .|.:|...|       .::|.
Human   285 KYYTDSIVNPDGFAGFPCASY--NVFTANKCFPCPSGGCPQM--GHYADRYPGKTNDVGQKFYLD 345

  Fly   307 TASKSPYA 314
            |...|.:|
Human   346 TGDASNFA 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 96/305 (31%)
PNLIPNP_000927.1 Lipase 17..352 CDD:278576 99/330 (30%)
PLAT_PL 355..465 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145217
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.