DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34447 and CG6295

DIOPT Version :9

Sequence 1:NP_001097060.1 Gene:CG34447 / 5740813 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster


Alignment Length:283 Identity:90/283 - (31%)
Similarity:140/283 - (49%) Gaps:17/283 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ISFWLYSNSTRENP--ILLDPLDLNPWNFQPPRPLKILIHGYTGDRDFAPNSYIRPVLLDHEDVY 104
            ::|:||:||.|.:|  |......::..:|.|..|.:..|||::..:|...|..:|.....|.|:.
  Fly    64 VTFYLYTNSNRNSPQEIKATSASISGSHFNPNHPTRFTIHGWSSSKDEFINYGVRDAWFTHGDMN 128

  Fly   105 VISIDYGPLVRYPCYIQAVQNLPLVSRCLAQLINNLVDRAIVANDQIHLIGFSLGGQVAGQTANY 169
            :|::|:| ..|...|..:|..:|.|...:|.|||.:.....:..|...:||.|||..|:|.....
  Fly   129 MIAVDWG-RARSVDYASSVLAVPGVGEQVATLINFMRSNHGLNLDNTMVIGHSLGAHVSGYAGKN 192

  Fly   170 VKR-KMKRITGLDPAKPLFILGPDSRRLDKGDADFVDVIHTDVFGRGYLRAAGHVDFYPNFGAKQ 233
            ||. ::..|.|||||.|||.....::||...||.:|:.|.|:....|:|:..|...||||.|..|
  Fly   193 VKNGQLHTIIGLDPALPLFSYDSPNKRLSSTDAYYVESIQTNGGTLGFLKPIGKGAFYPNGGKSQ 257

  Fly   234 PGCMEENMQDPSSCNHERAPRFYAESINTTVGFWARQCSGWLLQLLTLCPTTGAQALLG-----Y 293
            |||   .:....||.|.|:..:||||: |...|...:|..:...:...|.::.:...:|     |
  Fly   258 PGC---GVDLTGSCAHSRSVIYYAESV-TENNFPTMRCGDYEEAVAKECGSSYSSVRMGATTNAY 318

  Fly   294 HVSDELRGSYFLQTASKSPYALG 316
            .|:    |.|::...|.:||.:|
  Fly   319 MVA----GDYYVPVRSDAPYGMG 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 86/274 (31%)
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 86/274 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445921
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.