DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34447 and CG10116

DIOPT Version :9

Sequence 1:NP_001097060.1 Gene:CG34447 / 5740813 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster


Alignment Length:282 Identity:81/282 - (28%)
Similarity:131/282 - (46%) Gaps:32/282 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FWLYSNSTREN--PILLDPLDLNPWNFQPPRPLKILIHGYTGDRDFAPNSYIRPVLLDHEDVYVI 106
            |:|.:...:||  ||..:...|...:|....|..:.|..:.|:........:....|..:|..:|
  Fly    24 FFLNTRRVQENAQPIEAEVEALVRSSFYAADPTVVTIPRWLGNISSPEIPAVVSARLQQQDSNII 88

  Fly   107 SIDYGPLVRYPCYIQAVQNLPLVSRCLAQLINNLVDRAIVANDQIHLIGFSLGGQVAGQTANYVK 171
            |:|..........|.:|.:|.:|       ::|..|..:   |:|.::||:.|..:||..|..|:
  Fly    89 SVDLSEANDETEIIDSVASLVIV-------LHNQFDMPL---DRILVVGFAEGAHLAGGVAAKVQ 143

  Fly   172 ----RKMKRITGLDPAKPLFILGPD-SRRLDKGDADFVDVIHTDVFGRGYLRAAGHVDFYPNFGA 231
                |::.:||.|||:.     |.: ..:|.:.||:||:|:||:..|.|.....||||:|||.|.
  Fly   144 QDLGRQLSQITALDPSS-----GAELDHKLSQADAEFVEVVHTNAGGEGTWERLGHVDYYPNGGQ 203

  Fly   232 KQPGCMEENMQDPSSCNHERAPRFYAESINTTVGFWARQCSGWLLQLLTLCPTTGAQALLGYHVS 296
            .||||..:      ||:||||....||..:....|.:.:|..  ::.|:......:...:|....
  Fly   204 TQPGCTTD------SCSHERAFELLAEMWSPENDFVSARCGS--VETLSASSCRWSTHKMGQKQE 260

  Fly   297 DE--LRGSYFLQTASKSPYALG 316
            :|  ..|.|||:|...||::.|
  Fly   261 EEQPASGIYFLETRQSSPFSRG 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 78/273 (29%)
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 77/272 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438298
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.