DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34447 and lipca

DIOPT Version :9

Sequence 1:NP_001097060.1 Gene:CG34447 / 5740813 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_957316.1 Gene:lipca / 393997 ZFINID:ZDB-GENE-040426-1361 Length:514 Species:Danio rerio


Alignment Length:352 Identity:107/352 - (30%)
Similarity:146/352 - (41%) Gaps:73/352 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LLDPLDLNPWNFQPPRPLKILIHGYTGDRDFAP-NSYIRPVLLDHE-DVYVISIDYGPLV--RYP 117
            |..|..|:...|....||.|:|||::.|..... .|.:...|...| ::.|:..|:..|.  .||
Zfish    63 LFQPHTLDACGFNSSLPLAIIIHGWSVDGMMEKWISRLASALKSSEGNINVLIADWLTLAHQHYP 127

  Fly   118 CYIQAVQNLPLVSRCLAQLINNLVDRAIVANDQIHLIGFSLGGQVAGQTANYVK---RKMKRITG 179
            .   |.||..:|.:.:|.|::.|.|.......::||||:|||..::|...:.:.   |.:.||||
Zfish   128 I---AAQNTRIVGQDIAHLLSWLEDFKQFPLGKVHLIGYSLGAHISGFAGSNLAMSGRTLGRITG 189

  Fly   180 LDPAKPLFILGPDSRRLDKGDADFVDVIHTDVFGR-----GYLRAAGHVDFYPNFGAKQPGCMEE 239
            ||||.|:|.....:.||...||.|||.|||....|     |..:...|.|||||.|:.|||| :.
Zfish   190 LDPAGPMFEGMSHTDRLSPEDAKFVDAIHTFTLQRMGLSVGIKQPVAHFDFYPNGGSFQPGC-QL 253

  Fly   240 NMQD---------------PSSCNHERAPRFYAES-INTTVGFWARQCS-------GWLLQL-LT 280
            :||:               ...|.||||...:.:| :|......|.:||       |..|.. ..
Zfish   254 HMQNIYAHLAQHGIMGFEQTVKCAHERAVHLFIDSLLNKDKQIMAYKCSDNTAFDKGNCLDCRKN 318

  Fly   281 LCPTTGAQALLGYHVSDELRGS---YFLQTASKSPYALGKMQDVDNRQTLAKFHLNFDHNEID-- 340
            .|.|      |||.:.....|.   .||:|.|..||.|              ||..|....|:  
Zfish   319 RCNT------LGYDIKKVRTGKSKRLFLKTRSHMPYKL--------------FHYQFRIQFINQI 363

  Fly   341 DDYEPQLLEAFLELEAVKVVVKMDESE 367
            |..:|.|        .|.:...:.|||
Zfish   364 DKIDPTL--------TVSLSGTLGESE 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 92/290 (32%)
lipcaNP_957316.1 lipo_lipase 44..488 CDD:132274 107/352 (30%)
Pancreat_lipase_like 54..344 CDD:238363 92/290 (32%)
PLAT_LPL 351..485 CDD:238856 11/40 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.