DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34447 and lipg

DIOPT Version :9

Sequence 1:NP_001097060.1 Gene:CG34447 / 5740813 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_956422.1 Gene:lipg / 393096 ZFINID:ZDB-GENE-040426-699 Length:500 Species:Danio rerio


Alignment Length:266 Identity:83/266 - (31%)
Similarity:130/266 - (48%) Gaps:36/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 ILIHGYTGDRDFAP--NSYIRPVLLDHEDVYVISIDYGPLVR--YPCYIQAVQNLPLVSRCLAQL 136
            ::|||:|....|..  :..:..|.....:..|:.:|:..|..  ||   .||.:...|.:.:|.|
Zfish    91 LIIHGWTMSGMFESWMHKLVAAVQRRESEANVVVVDWLGLANQLYP---DAVNHTRRVGQSIATL 152

  Fly   137 INNLVDRAIVANDQIHLIGFSLGGQVAGQTANYVKRKMKRITGLDPAKPLFILGPDS-RRLDKGD 200
            ::.|.:...:..:.:|:||:|||..|||....:|...:.||||||||.|:| .|.|| .:|...|
Zfish   153 LDWLQEEEQLQLENVHIIGYSLGAHVAGYAGTFVNGIIGRITGLDPAGPMF-EGADSYNKLSPDD 216

  Fly   201 ADFVDVIHTDVFGRGYLRAA-------GHVDFYPNFGAKQPGC--------MEENMQDPSSCNHE 250
            ||||||:||  :.||.|..:       ||:|.|||.|..||||        ...|..:...|.||
Zfish   217 ADFVDVLHT--YTRGALGVSIGIQEPIGHIDIYPNGGDVQPGCTFGEFLSAASGNFMEAMKCEHE 279

  Fly   251 RAPRFYAESI-NTTVGFWARQCSG---WLLQLLTLCPTTGAQALLGYHVSDELR----GSYFLQT 307
            ||...:.:|: |.....:|.||:|   :...:...|......: :||: :.::|    ...:|:|
Zfish   280 RAVHLFVDSLMNKDHVSYAFQCTGPDRFKKGICLSCRKNRCNS-IGYN-AKKMRKRRNSKMYLKT 342

  Fly   308 ASKSPY 313
            .:.:|:
Zfish   343 RADTPF 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 82/260 (32%)
lipgNP_956422.1 lipo_lipase 55..488 CDD:132274 83/266 (31%)
Pancreat_lipase_like 65..344 CDD:238363 82/260 (32%)
PLAT_LPL 351..486 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.