DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34447 and CG6675

DIOPT Version :9

Sequence 1:NP_001097060.1 Gene:CG34447 / 5740813 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster


Alignment Length:287 Identity:88/287 - (30%)
Similarity:133/287 - (46%) Gaps:30/287 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FWLYSNSTRENPILLDPLDLN---PW---NFQPPRPLKILIHGYTGDRDFAPNSYIRPVLLDHED 102
            |:|:.   ||.|.....:|.:   .|   .|....|.:::|||:......:.|..::...|...:
  Fly   120 FYLFK---REFPECGREVDFSIERKWRHCGFNASLPTRLMIHGWMSQSRGSFNRDVKNAYLKKGE 181

  Fly   103 VYVISIDYGPLVRYPCYIQAVQNLPLVSRCLAQLINNLVDRAIVAN-DQIHLIGFSLGGQVAGQT 166
            ..||.:|:........|...|:.:......|||.|.|| :|...|: |.::|||.|||.|:||..
  Fly   182 YNVIVVDWSASSANINYFSVVKLIETFGAELAQFIRNL-NRQFGADFDSMYLIGHSLGAQIAGSA 245

  Fly   167 ANYVKR-KMKRITGLDPAKPLFILGPDSRRLDKGDADFVDVIHTDVFGRGYLRAAGHVDFYPNFG 230
            ...:|. |:..|..||||.|.|.......|:|..||.:|:.:||.. ..|:.|..|...||||:|
  Fly   246 GKRLKPVKVNTIFALDPAGPKFRHRGTEFRIDPSDAKYVESMHTSA-NFGFRRPTGSATFYPNYG 309

  Fly   231 AKQPGCMEENMQDPSSCNHERAPRFYAESINTTVGFWARQC----SGWLLQLLTLCPTTGAQAL- 290
            |.|..|..      ..|:|.|:.:.:|||||:.:|||...|    ..|      .|..:..|:: 
  Fly   310 AYQHSCYY------LGCSHIRSYQMFAESINSPLGFWGTPCIRDNGRW------QCDYSQRQSIQ 362

  Fly   291 LGYHVSDELRGSYFLQTASKSPYALGK 317
            :....|....|.::::|:|..|:||||
  Fly   363 MAGEPSIHKEGIFYVKTSSSDPFALGK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 82/277 (30%)
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 82/277 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445927
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.