DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34447 and CG13282

DIOPT Version :9

Sequence 1:NP_001097060.1 Gene:CG34447 / 5740813 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster


Alignment Length:308 Identity:118/308 - (38%)
Similarity:162/308 - (52%) Gaps:25/308 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PACQVVRGECPNKNISFWLYSNSTRENPI---------LLDPLDLNPWNFQPPRPLKILIHGYTG 83
            |....:...||:.::.:::|   ||.||:         .|:..:|....|.|..|.||:||||..
  Fly    63 PCKWAIGRSCPDPDVKYYIY---TRHNPMDRQCLHIDESLEKSNLTDSYFNPRYPTKIIIHGYNS 124

  Fly    84 DRDFAPNSYIRPVLLDHEDVYVISIDYGPLVRYPCYIQAVQNLPLVSRCLAQLINNLVDRAIVAN 148
            |....|...:|...|...|..:|.:|:..|...||||.||.|......|.|||:..||:   ..|
  Fly   125 DMFLHPLQQMREEYLAKADYNIIYVDWSILSPGPCYISAVHNTKHAGTCTAQLVERLVE---TGN 186

  Fly   149 DQIHLIGFSLGGQVAGQTANYVKRKMK-----RITGLDPAKPLFILGPDSRRLDKGDADFVDVIH 208
            ..||:||||||.||    .||:.|.:.     ||||||||.||||....:.:||..||.:|||||
  Fly   187 TDIHVIGFSLGAQV----PNYIARNLSSFMLPRITGLDPAMPLFITSGKADKLDPSDASYVDVIH 247

  Fly   209 TDVFGRGYLRAAGHVDFYPNFGAKQPGCMEENMQDPSSCNHERAPRFYAESINTTVGFWARQCSG 273
            |:...:|.:...||.|||.|.|..||||..:.: :..:|:|:|||.::.|||.:..|||...|||
  Fly   248 TNALVQGKMERCGHADFYMNGGIMQPGCNGQKI-NSFACSHQRAPAYFLESIRSPKGFWGWACSG 311

  Fly   274 WLLQLLTLCPTTGAQALLGYHVSDELRGSYFLQTASKSPYALGKMQDV 321
            ::..||.:||.|......|.::....||.:.:.|...||:||||..|:
  Fly   312 YISYLLGMCPPTNFLLEAGENIRPTTRGMFMIDTNDSSPFALGKWTDL 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 108/281 (38%)
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 111/294 (38%)
Pancreat_lipase_like 75..347 CDD:238363 108/282 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438295
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.