DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34447 and CG5162

DIOPT Version :9

Sequence 1:NP_001097060.1 Gene:CG34447 / 5740813 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster


Alignment Length:347 Identity:93/347 - (26%)
Similarity:143/347 - (41%) Gaps:85/347 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GLFDPACQVVRGECPNKNISFWLYSNSTRENPILLDPL-----------DLNPWNFQPPRPLKIL 77
            ||.:.:.|::.|      ..|...|||.  |.|....|           |:|..|||        
  Fly    55 GLLEGSKQLIAG------YPFEFVSNSL--NVICSQALASNKIKSKYSPDINKMNFQ-------- 103

  Fly    78 IHGYTGDRDF---APNSYIRPVLLD-------------------------------HEDVYVISI 108
            :......::|   :|.|..:..|.|                               ..||..:::
  Fly   104 LQTACEKKNFPLTSPESMWKSPLFDVKKKVVILATGWTTTVNGSDTIEVFSKAYNCRGDVNFVAV 168

  Fly   109 DYGPLVRYPCYIQAVQNLPLVSRCLAQLINNLVDRAIVANDQIHLIGFSLGGQVAGQTANYVK-- 171
            |....|. ..|..:..|...:...:|..:..|:|  :|..:.|||||.|||..:.|....:::  
  Fly   169 DAARFVD-TLYTWSAFNTEEIGENIALGLVKLLD--LVPVENIHLIGHSLGAHIVGSAGRHLQHL 230

  Fly   172 --RKMKRITGLDPAKPLFILGPDSRRLDKGDADFVDVIHTDVFGRGYLRAAGHVDFYPNFGAKQP 234
              :.:.||||||||||.|..|.....|.:|||.||||||::....|.....|.|||||  |...|
  Fly   231 TNQTIPRITGLDPAKPCFNEGEALSGLMRGDAHFVDVIHSNPGVLGKRDPVGDVDFYP--GGMSP 293

  Fly   235 ---GCMEENMQDPSSCNHERAPRFYAESI--NTTVGFWARQCSGWLLQLLTL-CPTTGAQALLGY 293
               ||..      .:|.|.|:..::||::  .....|.|.:|:. :.:|... ||  |.:..:||
  Fly   294 LAAGCFS------VTCAHARSWEYFAETVFPGNERNFMATRCNS-ISKLRDFRCP--GDEVPMGY 349

  Fly   294 HVSDELRGSYFLQTASKSPYAL 315
            .|...::|:|||:.::.:|:.:
  Fly   350 AVPQNIKGNYFLEVSASAPFGM 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 88/322 (27%)
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 81/296 (27%)
Pancreat_lipase_like 99..365 CDD:238363 79/287 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446022
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.