DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34447 and CG5966

DIOPT Version :9

Sequence 1:NP_001097060.1 Gene:CG34447 / 5740813 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_572286.1 Gene:CG5966 / 31532 FlyBaseID:FBgn0029831 Length:540 Species:Drosophila melanogaster


Alignment Length:316 Identity:97/316 - (30%)
Similarity:141/316 - (44%) Gaps:47/316 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FWLYSNSTRENPILL---DPLDLNPWNFQPPRPLKILIHGYTGDRDFAPNSYIRPVLLDHED--- 102
            |.|::....:.|..|   ||..:......|...:.:|:|||....:......:...||.||.   
  Fly    80 FTLHTRRALDQPKYLDLNDPESVQGMGMNPKGKIFLLVHGYLESGEIPWMWDMAKALLAHEPEGR 144

  Fly   103 VYVISIDYGPLVRYPCYIQAVQNLPLVSRCLAQLINNLVDRAIVAN-DQIHLIGFSLGGQVAGQT 166
            ..|:.||:|.... |.|:|||.|:.||....|.:::.|.:...:.| |.:|:||.|||..::|..
  Fly   145 ASVVLIDWGGGAS-PPYVQAVANIRLVGAITAHVVHMLYEELRLPNLDNVHIIGHSLGAHLSGYA 208

  Fly   167 ANYVKR----KMKRITGLDPAKPLFILGPDSRRLDKGDADFVDVIHTDV-----FGRGYLRAAGH 222
            ..:::.    |..||||||||.|||.......||||.||.|||::|||.     .|.|.....||
  Fly   209 GYHLQHDFGLKPARITGLDPAAPLFTDTDPIVRLDKTDAHFVDIVHTDANPLMKGGLGINMRLGH 273

  Fly   223 VDFYPNFGAKQPGCMEE------------NMQDPSSCNHERAPRFYAESINTTVGFWARQCSGWL 275
            |||:||.|...|||.::            .||:...|||.|:.:::.|||.:...|....|..:.
  Fly   274 VDFFPNGGFDNPGCNKKFQDVVKKKTLFLTMQEFLGCNHIRSQQYFTESIGSQCPFLGITCDSFE 338

  Fly   276 L---QLLTLCPTTGAQAL-LGYHVSDELR--------------GSYFLQTASKSPY 313
            .   ...|.|...|...| :|||..::.:              |.::|.|....|:
  Fly   339 SFKDTKCTSCEEPGHTCLRMGYHSQEDYQEQVDLGQLQQGDSPGVFYLWTGDSKPF 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 96/310 (31%)
CG5966NP_572286.1 Lipase 46..394 CDD:278576 96/314 (31%)
Pancreat_lipase_like 76..390 CDD:238363 96/310 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.