DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34447 and Pnlip

DIOPT Version :9

Sequence 1:NP_001097060.1 Gene:CG34447 / 5740813 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_037293.2 Gene:Pnlip / 25702 RGDID:3360 Length:465 Species:Rattus norvegicus


Alignment Length:351 Identity:108/351 - (30%)
Similarity:155/351 - (44%) Gaps:63/351 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TVWLPLLTLIWRSASANPILGLFDPACQVVRGECPNKNISFWLYSNSTREN--PILLDPLDLNPW 66
            |:..||..|.|..|..                     |..|.||:|..::|  .|..|...:...
  Rat    36 TIDRPLKALPWSPAQI---------------------NTRFLLYTNENQDNYQKITSDASSIRNS 79

  Fly    67 NFQPPRPLKILIHGY--TGDR----DFAPNSYIRPVLLDHEDVYVISIDYGPLVRYPCYIQAVQN 125
            ||:..|..:|:|||:  .|:.    |...|      :...|.|..|.:|:....| ..|.||.||
  Rat    80 NFKTNRKTRIIIHGFIDKGEENWLSDMCKN------MFKVESVNCICVDWKGGSR-ATYTQATQN 137

  Fly   126 LPLVSRCLAQLINNLVDRAIVANDQIHLIGFSLGGQVAGQTANYVKRKMKRITGLDPAKPLFILG 190
            :.:|...:|.|:|.|......:.|.:||||.|||..|||:........:.||||||.|:|.|...
  Rat   138 VRVVGAEVALLVNVLKSDLGYSPDNVHLIGHSLGSHVAGEAGKRTFGAIGRITGLDAAEPYFQGT 202

  Fly   191 PDSRRLDKGDADFVDVIHTDV------FGRGYLRAAGHVDFYPNFGAKQPGCME----------- 238
            |:..|||..||.|||.||||.      .|.|..:..||:||:||.|.:.|||.:           
  Rat   203 PEEVRLDPTDAQFVDAIHTDAAPIIPNLGFGMSQTVGHLDFFPNGGMEMPGCQKNILSQIVDIDG 267

  Fly   239 --ENMQDPSSCNHERAPRFYAESINTTVGFWARQCSGWLLQLLTLCPTTGAQAL--LGYHV---- 295
              |..:|.::|||.|:.::|.:||....||....||.:.:.....|...|::..  :|::.    
  Rat   268 IWEGTRDFAACNHLRSYKYYTDSIVNPTGFSGFSCSSYNVFSANKCFPCGSEGCPQMGHYADKYP 332

  Fly   296 --SDELRGSYFLQTASKSPYALGKMQ 319
              :.||...::|.|..||.:|..:.|
  Rat   333 GKTKELYQKFYLNTGDKSNFARWRYQ 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 98/302 (32%)
PnlipNP_037293.2 Lipase 17..352 CDD:395099 106/343 (31%)
PLAT_PL 355..465 CDD:238857 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338909
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.