DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34447 and PNLIPRP3

DIOPT Version :9

Sequence 1:NP_001097060.1 Gene:CG34447 / 5740813 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001011709.2 Gene:PNLIPRP3 / 119548 HGNCID:23492 Length:467 Species:Homo sapiens


Alignment Length:355 Identity:115/355 - (32%)
Similarity:152/355 - (42%) Gaps:85/355 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LIWRSASANPILGLFDPACQVVRGECPNK-NISFWLYSNSTRENPILLDPLD------LNPWNFQ 69
            |.|....:..::||         ...|.| |..|.||   |..||.....:.      :....|.
Human    32 LPWTRTFSTELVGL---------PWSPEKINTRFLLY---TIHNPNAYQEISAVNSSTIQASYFG 84

  Fly    70 PPRPLKILIHGYTGD----RDFAPNSYIRPVLLDHEDVYVISIDYGPLVRYPCYIQAVQNLPLVS 130
            ..:..:|.|.|:..|    ||..      .|||..||:..|::|:....|.  ||.||.||.:|.
Human    85 TDKITRINIAGWKTDGKWQRDMC------NVLLQLEDINCINLDWINGSRE--YIHAVNNLRVVG 141

  Fly   131 RCLAQLINNLVDRAIVANDQIHLIGFSLGGQVAGQTANYVKRKMKRITGLDPAKPLFILGPDSRR 195
            ..:|..|:.|:.:...:..::||||.|||..:||:..:.:. .:.||||||||.|.|...|...|
Human   142 AEVAYFIDVLMKKFEYSPSKVHLIGHSLGAHLAGEAGSRIP-GLGRITGLDPAGPFFHNTPKEVR 205

  Fly   196 LDKGDADFVDVIHTDV------FGRGYLRAAGHVDFYPNFGAKQPGC--------------MEEN 240
            ||..||:|||||||:.      .|.|.:.|.||:|||||.|...|||              .::.
Human   206 LDPSDANFVDVIHTNAARILFELGVGTIDACGHLDFYPNGGKHMPGCEDLITPLLKFNFNAYKKE 270

  Fly   241 MQDPSSCNHERAPRFYAESINTTVGFWARQCSGWLLQLLTL-------------CPTTGAQALLG 292
            |.....|||.|:.:||||||.....|.|..|..:     |.             |||.|      
Human   271 MASFFDCNHARSYQFYAESILNPDAFIAYPCRSY-----TSFKAGNCFFCSKEGCPTMG------ 324

  Fly   293 YHVSD-------ELRGS-YFLQTASKSPYA 314
             |.:|       :..|| |||.|.|.||:|
Human   325 -HFADRFHFKNMKTNGSHYFLNTGSLSPFA 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 105/318 (33%)
PNLIPRP3NP_001011709.2 Lipase 18..352 CDD:278576 113/352 (32%)
Pancreat_lipase_like 52..348 CDD:238363 105/319 (33%)
PLAT_PL 355..467 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145195
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.