DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34447 and Pnliprp2

DIOPT Version :9

Sequence 1:NP_001097060.1 Gene:CG34447 / 5740813 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_476554.1 Gene:Pnliprp2 / 117554 RGDID:620793 Length:482 Species:Rattus norvegicus


Alignment Length:289 Identity:94/289 - (32%)
Similarity:134/289 - (46%) Gaps:40/289 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FWLYSNSTRENP------ILLDPLDLNPWNFQPPRPLKILIHGYTGDRDFAPNSYIRPV---LLD 99
            |.||:|   |||      ...:|..:...|||..|..:.::||:.   |...:.::..:   :..
  Rat    69 FLLYTN---ENPNNYQKISATEPDTIKFSNFQLDRKTRFIVHGFI---DKGEDGWLLDMCKKMFQ 127

  Fly   100 HEDVYVISIDYGPLVRYPCYIQAVQNLPLVSRCLAQLINNLVDRAIVANDQIHLIGFSLGGQVAG 164
            .|.|..|.:|:....|.. |.||..|..:|...:|.|:..|......:.:.:||||.|||..|.|
  Rat   128 VEKVNCICVDWRRGSRTE-YTQASYNTRVVGAEIAFLVQVLSTEMGYSPENVHLIGHSLGAHVVG 191

  Fly   165 QTANYVKRKMKRITGLDPAKPLFILGPDSRRLDKGDADFVDVIHTD------VFGRGYLRAAGHV 223
            :....::..:.||||||||:|.|...|:..|||..||.||||||||      ..|.|..:..||:
  Rat   192 EAGRRLEGHVGRITGLDPAEPCFQGLPEEVRLDPSDAMFVDVIHTDSAPIIPYLGFGMSQKVGHL 256

  Fly   224 DFYPNFGAKQPGCME-------------ENMQDPSSCNHERAPRFYAESINTTVGFWARQCSGW- 274
            ||:||.|.:.|||.:             |..|:..:|||.|:.::||.||....||....||.: 
  Rat   257 DFFPNGGKEMPGCQKNILSTIVDINGIWEGTQNFVACNHLRSYKYYASSILNPDGFLGYPCSSYE 321

  Fly   275 LLQLLTL--CPTTGAQALLGYHVSDELRG 301
            ..|....  ||..|...:  .|.:|:..|
  Rat   322 KFQQNDCFPCPEEGCPKM--GHYADQFEG 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 94/289 (33%)
Pnliprp2NP_476554.1 Lipase 31..367 CDD:278576 94/289 (33%)
Pancreat_lipase_like 65..363 CDD:238363 94/289 (33%)
PLAT_PL 370..482 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.