DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34231 and AT5G03560

DIOPT Version :10

Sequence 1:NP_001097280.2 Gene:CG34231 / 5740811 FlyBaseID:FBgn0085260 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_001154694.1 Gene:AT5G03560 / 831789 AraportID:AT5G03560 Length:363 Species:Arabidopsis thaliana


Alignment Length:144 Identity:26/144 - (18%)
Similarity:58/144 - (40%) Gaps:13/144 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RQGRELKAVKVYTVASESRHLLIFGVPKINLQANLRTKLQGFGKVQSCISVTSEM-ASKMDLEAF 85
            :.||..:|:::::...:...:     |.:.....:.......|:.:..:.|...| ||.:...|:
plant   209 KDGRTHEALELFSQIKDKNRM-----PDVVAHTAIVEAYANAGQAKETLKVFMRMLASGVSPNAY 268

  Fly    86 TDVFAVKFERLEVARRAKKMLDAHQFYGGILHISYAPERESLEELREK-IQQRRHEVAFRIRRNQ 149
            |....:|    .:|...|...||.::...::....:|...:...:.|. :::.:.|.|..:.:..
plant   269 TYSVLIK----GLAADGKTHKDAKKYLLEMMGNGMSPNAATYTAVFEAFVREGKEESARELLQEM 329

  Fly   150 KDQTQVP--KKSRE 161
            |.:..||  |..||
plant   330 KGKGFVPDEKAVRE 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34231NP_001097280.2 RRM_SF 30..122 CDD:473069 13/92 (14%)
AT5G03560NP_001154694.1 PLN03085 20..>105 CDD:215566
PLN03081 <195..>322 CDD:215563 19/121 (16%)
PPR repeat 203..226 CDD:276811 3/16 (19%)
PPR_2 230..278 CDD:463778 9/51 (18%)
PPR repeat 234..261 CDD:276811 3/26 (12%)
PPR repeat 267..297 CDD:276811 7/33 (21%)
PPR repeat 303..332 CDD:276811 4/28 (14%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.