DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34297 and TOM70

DIOPT Version :9

Sequence 1:NP_001097696.1 Gene:CG34297 / 5740802 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_014278.3 Gene:TOM70 / 855602 SGDID:S000005065 Length:617 Species:Saccharomyces cerevisiae


Alignment Length:215 Identity:48/215 - (22%)
Similarity:84/215 - (39%) Gaps:48/215 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 ESFIITERKTPIPVISAPTSS--------------KEKSKPRTFNRIDRSKDR------------ 94
            :|| ||..||.|....|.|.:              :::.|..|.|: |..||.            
Yeast     2 KSF-ITRNKTAILATVAATGTAIGAYYYYNQLQQQQQRGKKNTINK-DEKKDTKDSQKETEGAKK 64

  Fly    95 ---------FPFMRQVEMDLDQRSK-ARLERERVAQNFRKLGNAEYRKGNYEAAMKVYTEAIENI 149
                     :|.....|.|...::. ...|:::.|...:..||..:|...|:.|:|.|..|:| :
Yeast    65 STAPSNPPIYPVSSNGEPDFSNKANFTAEEKDKYALALKDKGNQFFRNKKYDDAIKYYNWALE-L 128

  Fly   150 RDSHILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRAMAYKGLND--ESNFENCVK 212
            ::..:.|.|.:.|::..|..|: :|:......:|.....:..:.||.|.:||..  ::.|:..|.
Yeast   129 KEDPVFYSNLSACYVSVGDLKK-VVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDLSVL 192

  Fly   213 YARKFNSKQMDFIDDFLEKL 232
                  |...||.|..:|.:
Yeast   193 ------SLNGDFNDASIEPM 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 17/65 (26%)
TPR repeat 119..147 CDD:276809 9/27 (33%)
TPR repeat 152..183 CDD:276809 6/30 (20%)
TPR repeat 188..216 CDD:276809 7/29 (24%)
TOM70NP_014278.3 3a0801s09 1..614 CDD:273380 48/215 (22%)
TPR repeat 99..127 CDD:276809 9/27 (33%)
TPR repeat 131..161 CDD:276809 6/30 (20%)
TPR repeat 166..189 CDD:276809 6/22 (27%)
TPR repeat 330..358 CDD:276809
TPR repeat 363..391 CDD:276809
TPR repeat 396..426 CDD:276809
TPR repeat 431..459 CDD:276809
TPR repeat 465..493 CDD:276809
TPR repeat 498..537 CDD:276809
TPR repeat 542..567 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.