DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG34297 and STI1

DIOPT Version :9

Sequence 1:	NP_001097696.1	Gene:	CG34297 / 5740802	FlyBaseID:	FBgn0085326	Length:	233	Species:	Drosophila melanogaster
Sequence 2:	NP_014670.1	Gene:	STI1 / 854192	SGDID:	S000005553	Length:	589	Species:	Saccharomyces cerevisiae

Alignment Length:	99	Identity:	27/99 - (27%)
Similarity:	55/99 - (55%)	Gaps:	6/99 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   119 AQNFRKLGNAEYRKGNYEAAMKVYTEAIE-NIRDSHILYINRALCFIKSGKFKRGIVDCDFVLNK 182
            |..:::.|||.:...:|:.|::::|:||| :...:|:||.||:.|:....||...:.|.:..: |
Yeast     5 ADEYKQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECV-K 68

  Fly   183 LDEKNLRAWMYRAMAYKGLND----ESNFENCVK 212
            ::....:.:.....|:.||.|    |||::..::
Yeast    69 INPSWSKGYNRLGAAHLGLGDLDEAESNYKKALE 102

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG34297	NP_001097696.1	TPR_11	119..185	CDD:290150	20/66 (30%)
		TPR repeat	119..147	CDD:276809	8/27 (30%)
		TPR repeat	152..183	CDD:276809	9/30 (30%)
		TPR repeat	188..216	CDD:276809	7/29 (24%)
STI1	NP_014670.1	PLN03088	5..>106	CDD:215568	27/99 (27%)
		TPR repeat	5..33	CDD:276809	8/27 (30%)
		TPR repeat	39..69	CDD:276809	9/30 (30%)
		TPR repeat	74..102	CDD:276809	7/27 (26%)
		STI1	138..193	CDD:407696
		3a0801s09	203..>573	CDD:273380
		TPR repeat	262..290	CDD:276809
		TPR repeat	294..324	CDD:276809
		TPR repeat	336..363	CDD:276809
		PLN03088	396..>549	CDD:215568
		TPR repeat	396..424	CDD:276809
		TPR repeat	429..459	CDD:276809
		TPR repeat	464..490	CDD:276809
		STI1	527..581	CDD:407696
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0548
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810