DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34297 and CNS1

DIOPT Version :9

Sequence 1:NP_001097696.1 Gene:CG34297 / 5740802 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_009713.1 Gene:CNS1 / 852452 SGDID:S000000359 Length:385 Species:Saccharomyces cerevisiae


Alignment Length:163 Identity:41/163 - (25%)
Similarity:79/163 - (48%) Gaps:29/163 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 KPRTFNRIDRSKDRFPFM------------RQVEMDLDQRSKARLERERVAQNFRKLGNAEYRKG 133
            |.:|.:.|.:..:|.||.            ..||::..:......|...:|:||:|.||..|:..
Yeast    33 KDKTSDEILKEMNRMPFFMTKLDETDGAGGENVELEALKALAYEGEPHEIAENFKKQGNELYKAK 97

  Fly   134 NYEAAMKVYTEAI------ENIRDSHILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWM 192
            .::.|.::|::.:      ::|.:|  ||.|||.|.::...::|.|.||...|. ::.||::.:.
Yeast    98 RFKDARELYSKGLAVECEDKSINES--LYANRAACELELKNYRRCIEDCSKALT-INPKNVKCYY 159

  Fly   193 YRAMAYKGLN--DESNFENCVKYARKFNSKQMD 223
            ..:.|:..||  :|:      |.|..|.::::|
Yeast   160 RTSKAFFQLNKLEEA------KSAATFANQRID 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 22/71 (31%)
TPR repeat 119..147 CDD:276809 9/33 (27%)
TPR repeat 152..183 CDD:276809 12/30 (40%)
TPR repeat 188..216 CDD:276809 6/29 (21%)
CNS1NP_009713.1 3a0801s09 68..>218 CDD:273380 33/128 (26%)
TPR repeat 83..111 CDD:276809 9/27 (33%)
TPR repeat 120..150 CDD:276809 12/32 (38%)
Wheel 257..374 CDD:408742
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R218
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.