DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34297 and SWA2

DIOPT Version :9

Sequence 1:NP_001097696.1 Gene:CG34297 / 5740802 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_010606.1 Gene:SWA2 / 851918 SGDID:S000002728 Length:668 Species:Saccharomyces cerevisiae


Alignment Length:280 Identity:52/280 - (18%)
Similarity:98/280 - (35%) Gaps:78/280 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 YSLQHPQIDECFL----DSESTVEEVVRLLENLQVPNEEEAEGQEKPKRSLKSSTITEESFIITE 62
            ||..|.::::..|    ||.:.:     |.|:.:|  .|.....:.|.:.|  .|..|....||:
Yeast   246 YSKTHDKVEDYDLPQVNDSPNRI-----LFEDNEV--VENLPPADNPDQDL--LTDFETKIDITK 301

  Fly    63 RKTP-IPVISAPTS-----------------------------SKEKSKPRTFNRIDRSKDRFPF 97
            |..| :...|:|||                             ||.......||....:....| 
Yeast   302 RTAPDVSHSSSPTSGILIEENSRRNEPLIEDSLLDFSEGNLTNSKSNEDSTLFNENSNTDSTIP- 365

  Fly    98 MRQVEMDLDQRSKARLERERVAQNFRKLGNAEYRKGNYEAAMKVYTEAIENIRDSHILYI----N 158
            :..:|:......||:             |.:.::.|:|..:::.|.:::..:..:|.|.|    |
Yeast   366 ISDIELSGYNEFKAK-------------GTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSN 417

  Fly   159 RALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAW---MYRAMAYKGLND---------ESNFENCV 211
            .....:|.|::.:.|.:....| :|...:...|   :..:...:..||         ..:||:..
Yeast   418 IIASQLKIGEYSKSIENSSMAL-ELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLE 481

  Fly   212 KYARKFNSKQ----MDFIDD 227
            .:.:...:.|    .:|.||
Yeast   482 SFKKALETYQELIKKNFFDD 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 13/69 (19%)
TPR repeat 119..147 CDD:276809 4/27 (15%)
TPR repeat 152..183 CDD:276809 8/34 (24%)
TPR repeat 188..216 CDD:276809 5/39 (13%)
SWA2NP_010606.1 Ubiq-assoc 138..181 CDD:401184
TPR <374..497 CDD:223533 21/136 (15%)
TPR repeat 374..402 CDD:276809 6/40 (15%)
TPR repeat 407..441 CDD:276809 8/34 (24%)
TPR repeat 467..495 CDD:276809 3/27 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.