DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34297 and Ttc4

DIOPT Version :9

Sequence 1:NP_001097696.1 Gene:CG34297 / 5740802 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_006503471.1 Gene:Ttc4 / 72354 MGIID:1919604 Length:451 Species:Mus musculus


Alignment Length:230 Identity:49/230 - (21%)
Similarity:87/230 - (37%) Gaps:62/230 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 ERKTPIPVISAPTSS---KEKSKP-RTFNRIDRSKDRFP----FMRQVEMDLDQRSKARL----- 113
            |...|.|...|...:   |.:|:| |...|.|:.::.|.    ||::...::|......|     
Mouse     2 ESSEPEPTEDASMDAFLEKFQSQPYRGGFREDQWEEEFDKIPLFMKKAPSEIDPEEFPDLACLQS 66

  Fly   114 -----ER--ERVAQNFRKLGNAEYRKGNYEAAMKVYTEAIE------------------------ 147
                 :|  |..|:.::..||..:::.:|:.|:..|:|.::                        
Mouse    67 MIFDDDRYPEEQAKTYKDEGNDYFKEKDYKKAVLSYSEGLKKKCADPDLNAVLYTNRAAAQYYLG 131

  Fly   148 NIRDS-------------HILYINR-ALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRAMAY 198
            |:|.|             |:..|.| |||.::...|...:..||..| ::|.|..:....||.|.
Mouse   132 NVRSSLNDVLAAKKLKPGHLKAIIRGALCHLELKHFAEAVNWCDEGL-QIDAKEKKLLEIRAKAD 195

  Fly   199 KGLNDESNFENCVKYARKFNSKQMDFIDDFLEKLK 233
            |....|   |..::.|:....|:....:..|:.:|
Mouse   196 KLKRME---ERDLRKAKLKEKKEQHQNEALLQAIK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 20/103 (19%)
TPR repeat 119..147 CDD:276809 7/27 (26%)
TPR repeat 152..183 CDD:276809 11/44 (25%)
TPR repeat 188..216 CDD:276809 7/27 (26%)
Ttc4XP_006503471.1 3a0801s09 73..>218 CDD:273380 32/148 (22%)
TPR repeat 79..107 CDD:276809 7/27 (26%)
TPR repeat 116..146 CDD:276809 3/29 (10%)
TPR repeat 151..179 CDD:276809 9/28 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R218
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.