Sequence 1: | NP_001097696.1 | Gene: | CG34297 / 5740802 | FlyBaseID: | FBgn0085326 | Length: | 233 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006503471.1 | Gene: | Ttc4 / 72354 | MGIID: | 1919604 | Length: | 451 | Species: | Mus musculus |
Alignment Length: | 230 | Identity: | 49/230 - (21%) |
---|---|---|---|
Similarity: | 87/230 - (37%) | Gaps: | 62/230 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 ERKTPIPVISAPTSS---KEKSKP-RTFNRIDRSKDRFP----FMRQVEMDLDQRSKARL----- 113
Fly 114 -----ER--ERVAQNFRKLGNAEYRKGNYEAAMKVYTEAIE------------------------ 147
Fly 148 NIRDS-------------HILYINR-ALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRAMAY 198
Fly 199 KGLNDESNFENCVKYARKFNSKQMDFIDDFLEKLK 233 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34297 | NP_001097696.1 | TPR_11 | 119..185 | CDD:290150 | 20/103 (19%) |
TPR repeat | 119..147 | CDD:276809 | 7/27 (26%) | ||
TPR repeat | 152..183 | CDD:276809 | 11/44 (25%) | ||
TPR repeat | 188..216 | CDD:276809 | 7/27 (26%) | ||
Ttc4 | XP_006503471.1 | 3a0801s09 | 73..>218 | CDD:273380 | 32/148 (22%) |
TPR repeat | 79..107 | CDD:276809 | 7/27 (26%) | ||
TPR repeat | 116..146 | CDD:276809 | 3/29 (10%) | ||
TPR repeat | 151..179 | CDD:276809 | 9/28 (32%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R218 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |