DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG34297 and Sugt1

DIOPT Version :9

Sequence 1:	NP_001097696.1	Gene:	CG34297 / 5740802	FlyBaseID:	FBgn0085326	Length:	233	Species:	Drosophila melanogaster
Sequence 2:	NP_080750.1	Gene:	Sugt1 / 67955	MGIID:	1915205	Length:	336	Species:	Mus musculus

Alignment Length:	84	Identity:	25/84 - (29%)
Similarity:	35/84 - (41%)	Gaps:	23/84 - (27%)

- Green bases have known domain annotations that are detailed below.

  Fly   133 GNYEAAMKVYTEAIENIRDSHILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRAMA 197
            |:.:||::..|:|:|...|....|..||.|.|..||::.||.|.        :|:|
Mouse    25 GDPQAALEELTKALEQNPDDAQYYCQRAYCHILLGKYRDGIADV--------KKSL--------- 72

  Fly   198 YKGLNDESNFENCVKYARK 216
                  |.|..||....||
Mouse    73 ------ELNPNNCTALLRK 85

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG34297	NP_001097696.1	TPR_11	119..185	CDD:290150	17/51 (33%)
		TPR repeat	119..147	CDD:276809	5/13 (38%)
		TPR repeat	152..183	CDD:276809	10/30 (33%)
		TPR repeat	188..216	CDD:276809	5/27 (19%)
Sugt1	NP_080750.1	TPR 1	11..44		6/18 (33%)
		PLN03088	21..336	CDD:215568	25/84 (30%)
		Motor_domain	<38..>107	CDD:277568	20/71 (28%)
		TPR repeat	44..74	CDD:276809	12/52 (23%)
		TPR 2	45..78		14/55 (25%)
		TPR	45..78	CDD:197478	14/55 (25%)
		TPR 3	79..112		3/7 (43%)
		TPR repeat	79..107	CDD:276809	3/7 (43%)
		p23_CS_hSgt1_like	146..229	CDD:107239
		SGS	256..336	CDD:282811
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0548
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900