DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34297 and TTC31

DIOPT Version :9

Sequence 1:NP_001097696.1 Gene:CG34297 / 5740802 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_011531337.1 Gene:TTC31 / 64427 HGNCID:25759 Length:539 Species:Homo sapiens


Alignment Length:177 Identity:40/177 - (22%)
Similarity:68/177 - (38%) Gaps:23/177 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DECFLDSEST-VEEVVRLLENLQV-PNEEEAEGQEKPKRSLKSSTITEESFIITERKTPIPVISA 72
            :|..||..|| |...:|.:.:..: ...|:...||...|.|....:.:|.            .|.
Human   227 EEDSLDLSSTFVSLALRKVGDWPLSARREKGLNQEPQGRGLALQKMGQEE------------ESP 279

  Fly    73 PTSSKEKSKPRTFNRIDRSKDRFPFMRQVEMDL---DQRSKARLERE-RVAQNFRKLGNAEYRKG 133
            |...:.:..|:.     :.||......|..:|.   .|.|...|... :.:|...|||.:..:.|
Human   280 PREERPQQSPKV-----QEKDLGRLRPQDLLDFAPYPQASPGLLAAALQQSQELAKLGTSFAQNG 339

  Fly   134 NYEAAMKVYTEAIENIRDSHILYINRALCFIKSGKFKRGIVDCDFVL 180
            .|..|:.::|:|::.....|.|:.||:.|..:.|:....:.|....|
Human   340 FYHEAVVLFTQALKLNPQDHRLFGNRSFCHERLGQPAWALADAQVAL 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 17/62 (27%)
TPR repeat 119..147 CDD:276809 9/27 (33%)
TPR repeat 152..183 CDD:276809 8/29 (28%)
TPR repeat 188..216 CDD:276809
TTC31XP_011531337.1 TPR_11 324..390 CDD:290150 17/63 (27%)
TPR repeat 325..353 CDD:276809 9/27 (33%)
TPR repeat 358..388 CDD:276809 8/29 (28%)
TPR repeat 393..421 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.