DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34297 and zgc:123010

DIOPT Version :9

Sequence 1:NP_001097696.1 Gene:CG34297 / 5740802 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_005169572.1 Gene:zgc:123010 / 641500 ZFINID:ZDB-GENE-051120-15 Length:501 Species:Danio rerio


Alignment Length:250 Identity:46/250 - (18%)
Similarity:96/250 - (38%) Gaps:50/250 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EVVRLLENLQVPNEEEAEGQEK----PKRSLKSSTITE-ESFIITE-RKTPIPVISAPTSSKEKS 80
            |.|:..|:.:...|||.|.:|:    |...|..|..:| |..:::: .:.|:.:::...|....:
Zfish    79 ERVKKDESTEQEEEEEEEEEEEDDAGPDSELDESEESELEEVVVSKVEEKPVALLNKSPSGPPLA 143

  Fly    81 KPRTFNRID--RSKDRFP-----------FMRQVEMDLDQRSKARLERERVAQNFRKLGNAE--- 129
            .....||..  ||.:..|           .:..:......:.|::..:|..::....:|.:|   
Zfish   144 SGNKSNRQQGARSGEEDPGWDVNSAFVANAVSHIRPKAKSKGKSKENKENESRPAEVIGFSEAKT 208

  Fly   130 -------------YRKGNYEAAMKVYTEAIENIRDSHILYINRALCFIKSGKFKRGIVDCDFVLN 181
                         .::|.|..|:.::||||:.....:..:.||:.|:....::...:.|.     
Zfish   209 KRSASLVEKGIRFVQEGQYTQAVSLFTEAIKCDPKDYRFFGNRSYCYCCLEQYALALADA----- 268

  Fly   182 KLDEKNL-------RAWMYRAMAYKGLNDESNFENCVKYARKFNSKQMDFIDDFL 229
               ||::       :.:..|..|..||...|..|..::...|.:....:.::|.|
Zfish   269 ---EKSIQMAPDWPKGYYRRGSALMGLKRYSEAEKAMEQVLKLDGDCEEAVNDLL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 13/81 (16%)
TPR repeat 119..147 CDD:276809 8/43 (19%)
TPR repeat 152..183 CDD:276809 4/30 (13%)
TPR repeat 188..216 CDD:276809 6/34 (18%)
zgc:123010XP_005169572.1 TPR_11 214..276 CDD:290150 13/69 (19%)
TPR repeat 214..239 CDD:276809 6/24 (25%)
TPR repeat 244..274 CDD:276809 6/37 (16%)
TPR_11 250..309 CDD:290150 13/66 (20%)
TPR_2 279..309 CDD:285020 7/29 (24%)
TPR repeat 279..307 CDD:276809 6/27 (22%)
TPR_11 282..343 CDD:290150 8/38 (21%)
TPR repeat 313..343 CDD:276809 1/7 (14%)
RRM <364..>438 CDD:223796
RRM 370..436 CDD:214636
zf-CCCH 471..492 CDD:279036
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.