DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34297 and CG34274

DIOPT Version :9

Sequence 1:NP_001097696.1 Gene:CG34297 / 5740802 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster


Alignment Length:234 Identity:104/234 - (44%)
Similarity:147/234 - (62%) Gaps:14/234 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYSLQHPQIDECFLDSEST-VEEVVRLLENLQVPNEEEAEGQEKPKRSLKSSTITEESFIITERK 64
            ::..|||..||.||..:.| ||:|:..|:.|:..|:.::    ..||...:.|:.:...|:|.|.
  Fly    27 LFIYQHPAADESFLKEQPTKVEDVIEYLDVLENANKTDS----SKKRQKSTITMDDIKCIVTRRS 87

  Fly    65 TPIPVISAPTSSKEKSKPRTFNRIDRSKDRFPFMRQVEMDLDQRSKARLERERVAQNFRKLGNAE 129
                .:|..|..:.|:|....|     .::|.||||::.:.|.|..||.:||.||:.||::||.|
  Fly    88 ----AVSTTTFRRGKAKRALIN-----TNQFTFMRQIDSEPDDRVLAREQREDVAETFRRMGNYE 143

  Fly   130 YRKGNYEAAMKVYTEAIENIRDSHILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYR 194
            |||.|:..|...|::.|:.|:||.:||:||||||||..:||.||:|||:||.|:||..||||:||
  Fly   144 YRKLNFSLAKDYYSKGIQYIKDSPVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYR 208

  Fly   195 AMAYKGLNDESNFENCVKYARKFNSKQMDFIDDFLEKLK 233
            |.|||.||||.|||..|..||:||....||||:||:|::
  Fly   209 AAAYKRLNDEPNFEYSVDRARRFNRSDADFIDEFLDKMR 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 36/65 (55%)
TPR repeat 119..147 CDD:276809 12/27 (44%)
TPR repeat 152..183 CDD:276809 20/30 (67%)
TPR repeat 188..216 CDD:276809 19/27 (70%)
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 34/61 (56%)
TPR repeat 133..161 CDD:276809 12/27 (44%)
TPR repeat 166..197 CDD:276809 20/30 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449141
Domainoid 1 1.000 44 1.000 Domainoid score I4681
eggNOG 1 0.900 - - E2759_KOG0548
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005389
OrthoInspector 1 1.000 - - otm26027
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.