DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34297 and ttc12

DIOPT Version :9

Sequence 1:NP_001097696.1 Gene:CG34297 / 5740802 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_009289931.1 Gene:ttc12 / 563791 ZFINID:ZDB-GENE-071016-4 Length:707 Species:Danio rerio


Alignment Length:225 Identity:67/225 - (29%)
Similarity:110/225 - (48%) Gaps:17/225 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ECFLDSESTVEEVVRLLENLQVPNEEEAEGQEK---PKRSLKSSTITEESFIITERKTPIPVISA 72
            |.||.....:.|:||.|      |..||..||.   ....|.||...:|.|     ||.|.....
Zfish    15 EKFLRDVDQINELVRDL------NSSEASCQENAIVKTEQLISSLEQKEQF-----KTKINKTVI 68

  Fly    73 PTSSKEKSKPRTFNRIDRSKDRFPFMRQVEMDLDQRSKARLERERVAQNFRKLGNAEYRKGNYEA 137
            .|||.| :.|... |.:.|::...|::.:|.|.:.|.:.|..:|..|...|:.||..:.:|:||.
Zfish    69 NTSSSE-NNPLNI-RYESSQNPENFLKILEKDAEDRCQRRKMKEERANVLREQGNEAFTQGDYET 131

  Fly   138 AMKVYTEAIENIRDSHILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRAMAYKGLN 202
            |::.|||.:|.:||...||.|||..|||..::|..|.||::.| :.:||.::|:::...::..|.
Zfish   132 AVRFYTEGLEQLRDMQALYTNRAQAFIKLKRYKEAISDCEWAL-RCNEKCIKAFIHMGTSHLALK 195

  Fly   203 DESNFENCVKYARKFNSKQMDFIDDFLEKL 232
            |.:....|.:...:...::...:..:|.::
Zfish   196 DFTQSRICYRKILEIEPQRETMVKAYLRRV 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 27/65 (42%)
TPR repeat 119..147 CDD:276809 11/27 (41%)
TPR repeat 152..183 CDD:276809 13/30 (43%)
TPR repeat 188..216 CDD:276809 4/27 (15%)
ttc12XP_009289931.1 TPR_11 112..178 CDD:290150 27/66 (41%)
TPR repeat 113..141 CDD:276809 11/27 (41%)
TPR repeat 146..176 CDD:276809 13/30 (43%)
TPR_11 149..212 CDD:290150 19/63 (30%)
TPR_1 150..180 CDD:278916 13/30 (43%)
TPR repeat 181..209 CDD:276809 4/27 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I11095
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005389
OrthoInspector 1 1.000 - - otm26027
orthoMCL 1 0.900 - - OOG6_108547
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R218
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.