DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34297 and si:dkey-33c12.4

DIOPT Version :9

Sequence 1:NP_001097696.1 Gene:CG34297 / 5740802 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_021336269.1 Gene:si:dkey-33c12.4 / 560112 ZFINID:ZDB-GENE-030131-2527 Length:648 Species:Danio rerio


Alignment Length:219 Identity:42/219 - (19%)
Similarity:87/219 - (39%) Gaps:61/219 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IDECFLDSESTVEEVVRLLENLQVPNEEEAEGQEKPKRSLKSSTITEESFIITERKTPIP---VI 70
            ::.||:.:.:.:.:  |.||  |.|..::...|..||:..:|.          ::.|.:|   |.
Zfish   246 MNSCFVSNAAAIAK--RKLE--QKPKPDKKPAQANPKKQHESQ----------QKATVMPQKQVA 296

  Fly    71 SAPTSSKEKSKPRTFNRIDRSKDRFPFMRQVEMDLDQRSKARLERERVAQNFRKLGNAEYRKGNY 135
            ....:.:|......|           ..|.||:.:                   :||.....||.
Zfish   297 KEEVNGEESVNANDF-----------ITRSVELAV-------------------IGNEYAGSGNM 331

  Fly   136 EAAMKVYTEAIENIRDSHILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRAMAYKG 200
            |.|:|.:|:||::....:.|:.||:.|:.|..::::.:.|.:..|: ::.|.::....:..|..|
Zfish   332 EMAVKYFTDAIKHNPKEYKLFGNRSYCYEKMLQYEKSLTDAEIALS-MNPKWIKGLYRKGRALVG 395

  Fly   201 LNDESNFENCVKYARKFNSKQMDF 224
            |             :::|..::.|
Zfish   396 L-------------KRYNEARLTF 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 17/65 (26%)
TPR repeat 119..147 CDD:276809 9/27 (33%)
TPR repeat 152..183 CDD:276809 7/30 (23%)
TPR repeat 188..216 CDD:276809 3/27 (11%)
si:dkey-33c12.4XP_021336269.1 PLN03088 258..>439 CDD:330826 40/207 (19%)
TPR repeat 348..378 CDD:276809 7/30 (23%)
TPR repeat 383..411 CDD:276809 5/37 (14%)
UBA 430..456 CDD:270456
RRM <471..>614 CDD:223796
RRM 519..584 CDD:214636
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.