DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34297 and stip1

DIOPT Version :9

Sequence 1:NP_001097696.1 Gene:CG34297 / 5740802 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001007767.1 Gene:stip1 / 493606 ZFINID:ZDB-GENE-041121-17 Length:542 Species:Danio rerio


Alignment Length:150 Identity:41/150 - (27%)
Similarity:72/150 - (48%) Gaps:6/150 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 KEKSKPRTFNRI---DRSKDRFPFMRQVEMDLDQRSKARLERERVAQNFRKLGNAEYRKGNYEAA 138
            |.|...:.||:.   .|:.|.....::.|..|.::.|.......:|...:..||..::||:|..|
Zfish   314 KYKEAVQFFNKSLTEHRTPDVLKKCQEAEKILKEQEKVAYINPDLALEEKNKGNDAFQKGDYPLA 378

  Fly   139 MKVYTEAIENIRDSHILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRAMAYKGLND 203
            ||.|:|||:.......|:.|||.|:.|..:|:..:.||:..:| ||...::.:..:..|.:.:.|
Zfish   379 MKHYSEAIKRNPYDAKLFSNRAACYTKLLEFQLALKDCEECIN-LDSTFIKGYTRKGAALEAMKD 442

  Fly   204 ESNFENCVKYARKF--NSKQ 221
            .|...:..:.|.:.  |||:
Zfish   443 FSKAMDVYQKALELDSNSKE 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 24/65 (37%)
TPR repeat 119..147 CDD:276809 12/27 (44%)
TPR repeat 152..183 CDD:276809 10/30 (33%)
TPR repeat 188..216 CDD:276809 4/27 (15%)
stip1NP_001007767.1 TPR_11 7..69 CDD:290150
TPR 7..37 CDD:197478
TPR repeat 7..32 CDD:276809
TPR repeat 37..67 CDD:276809
TPR_11 40..103 CDD:290150
TPR repeat 72..100 CDD:276809
TPR_11 224..285 CDD:290150
TPR repeat 228..252 CDD:276809
TPR_1 230..257 CDD:278916
TPR_12 254..327 CDD:290160 4/12 (33%)
TPR repeat 257..287 CDD:276809
TPR 299..327 CDD:197478 4/12 (33%)
TPR repeat 299..326 CDD:276809 4/11 (36%)
TPR_11 359..423 CDD:290150 23/64 (36%)
TPR repeat 363..387 CDD:276809 11/23 (48%)
TPR repeat 392..422 CDD:276809 10/30 (33%)
TPR_1 427..459 CDD:278916 4/31 (13%)
TPR repeat 427..455 CDD:276809 4/27 (15%)
STI1 491..530 CDD:128966
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.