DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34297 and CG6980

DIOPT Version :9

Sequence 1:NP_001097696.1 Gene:CG34297 / 5740802 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster


Alignment Length:233 Identity:83/233 - (35%)
Similarity:133/233 - (57%) Gaps:17/233 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 HPQIDECFLDSESTVEEVVRLLENLQVPNEEE---AEGQEKPKRSLKSSTITEESFIITERKTPI 67
            :|.:.:.|.:.|:|:.::..:|:| :.|.::|   |.|..|.|.:..:..:.:....:.|.:|  
  Fly    22 NPSVADDFAEFEATLAKIDCILQN-KAPCDDEDSKAGGDAKEKINFDNLDVDKVRLKVKENRT-- 83

  Fly    68 PVISAPTSSKEKSKPRTFNRIDRSKD--RFPFMRQVEMDLDQRSKARLERERVAQNFRKLGNAEY 130
             ||:..:..::..|        :.||  :..||.|||.|.:.|::||.:.|..|:..|..||..:
  Fly    84 -VINRKSLEEDNEK--------QVKDMNQKSFMEQVEKDANDRAEARAKAEYEAELQRSQGNEAF 139

  Fly   131 RKGNYEAAMKVYTEAIENIRDSHILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRA 195
            |...||.|:..|.:||..::||.|.|.|||||:||...:||.:.||.:||.||.|.|||||:|:|
  Fly   140 RSQKYEKAILHYDKAIIKVKDSAITYCNRALCYIKLQNYKRALKDCQYVLEKLQESNLRAWLYQA 204

  Fly   196 MAYKGLNDESNFENCVKYARKFNSKQMDFIDDFLEKLK 233
            .|||||..:..||..|..||:.|.||:.:||.::::|:
  Fly   205 HAYKGLKQDDKFEESVVKAREHNPKQLAYIDKYIKQLE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 30/65 (46%)
TPR repeat 119..147 CDD:276809 10/27 (37%)
TPR repeat 152..183 CDD:276809 16/30 (53%)
TPR repeat 188..216 CDD:276809 15/27 (56%)
CG6980NP_651289.1 TPR_11 127..190 CDD:290150 27/62 (44%)
TPR repeat 128..156 CDD:276809 10/27 (37%)
TPR repeat 161..192 CDD:276809 16/30 (53%)
TPR_1 162..190 CDD:278916 14/27 (52%)
TPR repeat 197..225 CDD:276809 15/27 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449139
Domainoid 1 1.000 44 1.000 Domainoid score I4681
eggNOG 1 0.900 - - E2759_KOG0548
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005389
OrthoInspector 1 1.000 - - otm26027
orthoMCL 1 0.900 - - OOG6_108547
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R218
SonicParanoid 00.000 Not matched by this tool.
87.670

Return to query results.
Submit another query.