DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34297 and Stip1

DIOPT Version :9

Sequence 1:NP_001097696.1 Gene:CG34297 / 5740802 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_477354.1 Gene:Stip1 / 33202 FlyBaseID:FBgn0024352 Length:490 Species:Drosophila melanogaster


Alignment Length:247 Identity:60/247 - (24%)
Similarity:105/247 - (42%) Gaps:50/247 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLQHPQIDECFLDSESTV-------EEVVRLLE-NLQVPNEEEAE-----------GQEKPK-RS 47
            :::|...|..|.::.:.|       ||.::..| .::|..|..|:           |....| .:
  Fly   201 AIEHDPTDITFYNNIAAVHFERKEYEECIKQCEKGIEVGRESRADFKLIAKSFARIGNTYRKLEN 265

  Fly    48 LKSSTITEESFIITERKTP-IPVISAPTSSKEKSKPRTFNRIDRSKDRFPFMRQVEMDLDQRSKA 111
            .|.:.:..|. .::|.:|| |....:...:|.|.:.|                   |......||
  Fly   266 YKQAKVYYEK-AMSEHRTPEIKTSLSEVEAKIKEEER-------------------MAYINPEKA 310

  Fly   112 RLERERVAQNFRKLGNAEYRKGNYEAAMKVYTEAIENIRDSHILYINRALCFIKSGKFKRGIVDC 176
            ..|:|:        ||..::||:|..|:|.|||||:...|...||.|||.|:.|...|..|:.||
  Fly   311 EEEKEQ--------GNLFFKKGDYSTAVKHYTEAIKRNPDDPKLYSNRAACYTKLAAFDLGLKDC 367

  Fly   177 DFVLNKLDEKNLRAWMYRAMAYKGLNDESNFENCVKYARKFNSKQMDFIDDF 228
            |..: |||||.::.::.:....:|:..:|..:...:.|.:.:....:.|:.:
  Fly   368 DTCI-KLDEKFIKGYIRKGKILQGMQQQSKAQAAYQKALELDPNNAEAIEGY 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 27/65 (42%)
TPR repeat 119..147 CDD:276809 11/27 (41%)
TPR repeat 152..183 CDD:276809 12/30 (40%)
TPR repeat 188..216 CDD:276809 3/27 (11%)
Stip1NP_477354.1 TPR_11 6..69 CDD:290150
TPR repeat 7..32 CDD:276809
TPR repeat 37..67 CDD:276809
TPR_11 40..103 CDD:290150
TPR repeat 72..100 CDD:276809
TPR_11 175..237 CDD:290150 7/35 (20%)
TPR repeat 175..203 CDD:276809 0/1 (0%)
TPR_1 181..208 CDD:278916 1/6 (17%)
TPR_12 205..278 CDD:290160 13/73 (18%)
TPR repeat 208..238 CDD:276809 6/29 (21%)
TPR repeat 250..278 CDD:276809 4/28 (14%)
TPR_1 250..>276 CDD:278916 4/26 (15%)
TPR_11 309..375 CDD:290150 31/74 (42%)
TPR repeat 310..338 CDD:276809 14/35 (40%)
TPR_1 <317..343 CDD:278916 12/25 (48%)
TPR repeat 343..373 CDD:276809 12/30 (40%)
TPR_1 378..411 CDD:278916 3/32 (9%)
TPR repeat 378..406 CDD:276809 3/27 (11%)
STI1 439..478 CDD:128966
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0548
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.