DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34297 and Ttc12

DIOPT Version :9

Sequence 1:NP_001097696.1 Gene:CG34297 / 5740802 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_006243066.1 Gene:Ttc12 / 300696 RGDID:1303264 Length:723 Species:Rattus norvegicus


Alignment Length:224 Identity:60/224 - (26%)
Similarity:106/224 - (47%) Gaps:27/224 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EVVRLLENL-QVPNEEEAEGQEKPKRSLKSSTITEESFIITER------------KTPIPVISAP 73
            ::.|.|||: ::.|..:....:.|....|:...||:..::.||            ||.|....||
  Rat    27 DLQRFLENVDEITNLIQEMNSDDPFIQQKAVLDTEKKLLLMEREQEEDGCRTTLNKTMISPPQAP 91

  Fly    74 TSSKEKSKPRTFNRIDRSKDRFPFMRQVEMDLDQRSKARLERERVAQNFRKLGNAEYRKGNYEAA 138
            .::.|.:..             .|:..||.|..:|:|.|.|...:|...::.||..:.||:||.|
  Rat    92 ENANEMNPD-------------AFLASVEKDAKERAKRRRENRVLADALKEKGNEAFVKGDYETA 143

  Fly   139 MKVYTEAIENIRDSHILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRAMAYKGLND 203
            :..|:|.:..::|..:||.|||..:||.|.:::.:||||:.| |.||...:|:.:...|:..|.:
  Rat   144 IFFYSEGLGKLKDMKVLYTNRAQAYIKLGDYQKALVDCDWAL-KCDENCTKAYFHMGKAHLALKN 207

  Fly   204 ESNFENCVKYARKFNSKQMDFIDDFLEKL 232
            .|..:.|.:...:.|.|....:.:.|.::
  Rat   208 YSKSKECYQKIGEINPKLKAQVKEHLNQV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 25/65 (38%)
TPR repeat 119..147 CDD:276809 10/27 (37%)
TPR repeat 152..183 CDD:276809 13/30 (43%)
TPR repeat 188..216 CDD:276809 5/27 (19%)
Ttc12XP_006243066.1 TPR_11 124..189 CDD:290150 25/65 (38%)
TPR repeat 124..152 CDD:276809 10/27 (37%)
TPR repeat 157..187 CDD:276809 13/30 (43%)
TPR_11 160..223 CDD:290150 21/63 (33%)
TPR_1 161..191 CDD:278916 15/30 (50%)
TPR repeat 192..217 CDD:276809 5/24 (21%)
TPR_1 193..224 CDD:278916 6/30 (20%)
ARM 631..723 CDD:237987
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005389
OrthoInspector 1 1.000 - - otm44459
orthoMCL 1 0.900 - - OOG6_108547
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.