DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34297 and cns1

DIOPT Version :9

Sequence 1:NP_001097696.1 Gene:CG34297 / 5740802 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_594238.1 Gene:cns1 / 2542172 PomBaseID:SPAC17A2.04c Length:358 Species:Schizosaccharomyces pombe


Alignment Length:182 Identity:45/182 - (24%)
Similarity:76/182 - (41%) Gaps:30/182 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SSKEKSKPRTFNRIDRSKDRFPFMRQVEMDLDQRSKARL------------ERERVAQNFRKLGN 127
            ::|.|:....||.:    ::.||..|...|:...|:..:            |...||||||:.||
pombe    12 NTKNKNAEEMFNEL----NKVPFFMQSLEDVGDESENNVQLDALKALAYEGEPHEVAQNFREHGN 72

  Fly   128 AEYRKGNYEAAMKVYTEAI-ENIRDSHI---LYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNL 188
            ..:....|:.|.:.||:|: :...|..|   .|.|||.|.:....:::.:.||..||.: |..:.
pombe    73 ECFASKRYKDAEEFYTKALAQKCGDKDIEIACYSNRAACNLLFENYRQVLNDCAQVLQR-DSTHA 136

  Fly   189 RAWMYRAMAYKGLNDESNFENCVKYARKFN---------SKQMDFIDDFLEK 231
            :|:...|.|...|......:.|::.....:         ||::....|..||
pombe   137 KAYYRSAKALVALKRYDEAKECIRLCSLVHPNDPAILALSKELQKKSDDFEK 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 23/69 (33%)
TPR repeat 119..147 CDD:276809 12/28 (43%)
TPR repeat 152..183 CDD:276809 10/33 (30%)
TPR repeat 188..216 CDD:276809 5/27 (19%)
cns1NP_594238.1 TPR_11 64..132 CDD:290150 23/68 (34%)
TPR repeat 64..92 CDD:276809 12/27 (44%)
TPR repeat 97..131 CDD:276809 11/33 (33%)
TPR_19 116..175 CDD:291240 10/59 (17%)
TPR repeat 136..160 CDD:276809 5/23 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R218
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.