DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34297 and Stip1

DIOPT Version :9

Sequence 1:NP_001097696.1 Gene:CG34297 / 5740802 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_620266.1 Gene:Stip1 / 192277 RGDID:621599 Length:543 Species:Rattus norvegicus


Alignment Length:157 Identity:44/157 - (28%)
Similarity:74/157 - (47%) Gaps:19/157 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 DRSKDRFPFMRQ---------VEMDLDQRSKARLERERVAQ-------NFRKLGNAEYRKGNYEA 137
            :|.||...|..:         |.....|..|...|:||:|.       ..:..||..::||:|..
  Rat   314 ERYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQ 378

  Fly   138 AMKVYTEAIE-NIRDSHILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRAMAYKGL 201
            |||.|||||: |.||:. ||.|||.|:.|..:|:..:.||:..: :|:...::.:..:|.|.:.:
  Rat   379 AMKHYTEAIKRNPRDAK-LYSNRAACYTKLLEFQLALKDCEECI-QLEPTFIKGYTRKAAALEAM 441

  Fly   202 NDESNFENCVKYARKFNSKQMDFIDDF 228
            .|.:...:..:.|...:|...:..|.:
  Rat   442 KDYTKAMDVYQKALDLDSSCKEAADGY 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 28/73 (38%)
TPR repeat 119..147 CDD:276809 13/34 (38%)
TPR repeat 152..183 CDD:276809 10/30 (33%)
TPR repeat 188..216 CDD:276809 4/27 (15%)
Stip1NP_620266.1 TPR 1 4..37
3a0801s09 <7..532 CDD:273380 44/157 (28%)
TPR repeat 7..32 CDD:276809
TPR repeat 37..67 CDD:276809
TPR 2 39..71
TPR repeat 72..100 CDD:276809
TPR 3 73..105
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..233
Bipartite nuclear localization signal. /evidence=ECO:0000255 222..239
TPR 4 225..258
TPR repeat 229..253 CDD:276809
TPR repeat 258..288 CDD:276809
TPR 5 260..292
TPR 6 300..333 4/18 (22%)
TPR repeat 300..328 CDD:276809 4/13 (31%)
TPR 7 360..393 14/32 (44%)
TPR repeat 364..388 CDD:276809 12/23 (52%)
TPR repeat 393..423 CDD:276809 11/31 (35%)
TPR 8 395..427 11/33 (33%)
TPR 9 428..461 5/32 (16%)
TPR repeat 428..456 CDD:276809 4/27 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.