DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34297 and Y22D7AL.9

DIOPT Version :9

Sequence 1:NP_001097696.1 Gene:CG34297 / 5740802 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_497427.2 Gene:Y22D7AL.9 / 175314 WormBaseID:WBGene00021247 Length:836 Species:Caenorhabditis elegans


Alignment Length:263 Identity:49/263 - (18%)
Similarity:86/263 - (32%) Gaps:91/263 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QIDECFLDSESTVEEVVRLLENLQVPNEEEAEGQEKPKRSLKSSTITEESFIITERKTPIPVISA 72
            |::....|.|:..|....:.:.|..|:|:......| .|.|:|:.|:||:               
 Worm   465 QLEGIMDDVEAVFERAQGICDRLSRPSEKVPYISAK-YRWLQSTGISEEA--------------- 513

  Fly    73 PTSSKEKSKPRTFNRIDRSKDRFPFMRQVEMDLDQRSKARLERERVAQNFRKLG----------- 126
                            ::......|..:.:.:||.::|:.:..:...:|..|:|           
 Worm   514 ----------------EKCLKMLEFWLKTDQNLDSKAKSLIFEDLSLENRPKIGKLIALEQALTE 562

  Fly   127 ----NAEYR-------------KGNYEAAMKVYTEAIE---------NIRDSHILYINRALCFIK 165
                |..||             :.|.:.|.|.|.:.:|         .:.|:|....|  |.|: 
 Worm   563 AQDTNDMYREAGILEKMGHFLAENNEKLAEKYYNQQLEVGKQLKNAKMMADAHANVAN--LKFL- 624

  Fly   166 SGKFKRGIVD--CDFVLNKLDEKN----------LRAWMYR-------AMAYKGLNDESNFENCV 211
            :||:......  |...:.||...|          .||.:.|       :...|.:|...:.||..
 Worm   625 AGKYPEACEHSRCALTIFKLASNNEKKVEMLILLARAELERNNTEIALSAVEKSINLAEDCENNE 689

  Fly   212 KYA 214
            |.|
 Worm   690 KLA 692

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 21/104 (20%)
TPR repeat 119..147 CDD:276809 10/55 (18%)
TPR repeat 152..183 CDD:276809 7/32 (22%)
TPR repeat 188..216 CDD:276809 9/34 (26%)
Y22D7AL.9NP_497427.2 PEP_TPR_lipo <9..93 CDD:274350
TPR repeat 38..68 CDD:276809
TPR repeat 73..96 CDD:276809
TPR_12 611..684 CDD:315987 16/75 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.