DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34297 and STIP1

DIOPT Version :9

Sequence 1:NP_001097696.1 Gene:CG34297 / 5740802 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001269581.1 Gene:STIP1 / 10963 HGNCID:11387 Length:590 Species:Homo sapiens


Alignment Length:205 Identity:46/205 - (22%)
Similarity:92/205 - (44%) Gaps:38/205 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NEEEAEGQEKPKRSLKSSTITEESF---------IITERKTPIPVISAPTSSKEKSKPRTFNRID 89
            |.|:.....|....:.:|...||.:         .:.|.:||..:          .|.:...:|.
Human   339 NREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVL----------KKCQQAEKIL 393

  Fly    90 RSKDRFPFMRQVEMDLDQRSKARLERERVAQNFRKLGNAEYRKGNYEAAMKVYTEAIE-NIRDSH 153
            :.::|..::.. ::.|::::|               ||..::||:|..|||.|||||: |.:|:.
Human   394 KEQERLAYINP-DLALEEKNK---------------GNECFQKGDYPQAMKHYTEAIKRNPKDAK 442

  Fly   154 ILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRAMAYKGLNDESNFENCVKYARKFN 218
             ||.|||.|:.|..:|:..:.||:..: :|:...::.:..:|.|.:.:.|.:...:..:.|...:
Human   443 -LYSNRAACYTKLLEFQLALKDCEECI-QLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLD 505

  Fly   219 SKQMDFIDDF 228
            |...:..|.:
Human   506 SSCKEAADGY 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 26/66 (39%)
TPR repeat 119..147 CDD:276809 12/27 (44%)
TPR repeat 152..183 CDD:276809 10/30 (33%)
TPR repeat 188..216 CDD:276809 4/27 (15%)
STIP1NP_001269581.1 PLN03088 <54..579 CDD:330826 46/205 (22%)
TPR repeat 54..79 CDD:276809
TPR repeat 84..114 CDD:276809
TPR repeat 119..147 CDD:276809
TPR repeat 276..300 CDD:276809
TPR repeat 305..335 CDD:276809
TPR repeat 347..375 CDD:276809 4/27 (15%)
TPR repeat 411..435 CDD:276809 13/38 (34%)
TPR repeat 440..470 CDD:276809 11/31 (35%)
TPR repeat 475..503 CDD:276809 4/27 (15%)
TPR repeat 509..538 CDD:276809 1/7 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.