Sequence 1: | NP_001097696.1 | Gene: | CG34297 / 5740802 | FlyBaseID: | FBgn0085326 | Length: | 233 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001269581.1 | Gene: | STIP1 / 10963 | HGNCID: | 11387 | Length: | 590 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 46/205 - (22%) |
---|---|---|---|
Similarity: | 92/205 - (44%) | Gaps: | 38/205 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 NEEEAEGQEKPKRSLKSSTITEESF---------IITERKTPIPVISAPTSSKEKSKPRTFNRID 89
Fly 90 RSKDRFPFMRQVEMDLDQRSKARLERERVAQNFRKLGNAEYRKGNYEAAMKVYTEAIE-NIRDSH 153
Fly 154 ILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRAMAYKGLNDESNFENCVKYARKFN 218
Fly 219 SKQMDFIDDF 228 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34297 | NP_001097696.1 | TPR_11 | 119..185 | CDD:290150 | 26/66 (39%) |
TPR repeat | 119..147 | CDD:276809 | 12/27 (44%) | ||
TPR repeat | 152..183 | CDD:276809 | 10/30 (33%) | ||
TPR repeat | 188..216 | CDD:276809 | 4/27 (15%) | ||
STIP1 | NP_001269581.1 | PLN03088 | <54..579 | CDD:330826 | 46/205 (22%) |
TPR repeat | 54..79 | CDD:276809 | |||
TPR repeat | 84..114 | CDD:276809 | |||
TPR repeat | 119..147 | CDD:276809 | |||
TPR repeat | 276..300 | CDD:276809 | |||
TPR repeat | 305..335 | CDD:276809 | |||
TPR repeat | 347..375 | CDD:276809 | 4/27 (15%) | ||
TPR repeat | 411..435 | CDD:276809 | 13/38 (34%) | ||
TPR repeat | 440..470 | CDD:276809 | 11/31 (35%) | ||
TPR repeat | 475..503 | CDD:276809 | 4/27 (15%) | ||
TPR repeat | 509..538 | CDD:276809 | 1/7 (14%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0548 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |