DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34297 and ttc12

DIOPT Version :9

Sequence 1:NP_001097696.1 Gene:CG34297 / 5740802 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_004916149.1 Gene:ttc12 / 101732246 XenbaseID:XB-GENE-955705 Length:714 Species:Xenopus tropicalis


Alignment Length:222 Identity:65/222 - (29%)
Similarity:110/222 - (49%) Gaps:12/222 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ECFLDSESTVEEVVRLLENLQVPNEEEAEGQEKPKRSLKSSTITEESFIITERKTPIPVISAPTS 75
            |.||.:...:.::::.|.:....:.:||..:...:.:|..:...::....|..:|.|.  ::|..
 Frog     8 ESFLKNIDEITDIIQDLNSSDESHRQEAFLKADKRLALLKNKDNDDGIRTTANRTVIN--TSPEG 70

  Fly    76 SKEKSKPRTFNRIDRSKDRFPFMRQVEMDLDQRSKARLERERVAQNFRKLGNAEYRKGNYEAAMK 140
            ..........|:..|.... ..:..:|.|..:|::.|.|...:|...::|||..:.||:||.|:|
 Frog    71 MCASGSTYHANKDSRLMQE-NVLEHLEKDAKERAERRKENTAMANALKELGNKAFSKGDYETAVK 134

  Fly   141 VYTEAIENIRDSHILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRAMAYKGLNDES 205
            .|:|.:|.:||..:||.|||..|||..|::..|.||.:.| |.:||..:|:::...||.||.:.|
 Frog   135 CYSEGVEKLRDMQVLYTNRAQAFIKLEKYENAISDCQWAL-KCNEKCAKAYVHMGKAYLGLKEYS 198

  Fly   206 NFENCVKYARKFNSKQMDFIDDFLEKL 232
            .       |||...|.:| :|..||||
 Frog   199 E-------ARKCYLKLLD-VDPNLEKL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 29/65 (45%)
TPR repeat 119..147 CDD:276809 12/27 (44%)
TPR repeat 152..183 CDD:276809 13/30 (43%)
TPR repeat 188..216 CDD:276809 7/27 (26%)
ttc12XP_004916149.1 PLN03088 112..>220 CDD:215568 47/115 (41%)
TPR repeat 113..141 CDD:276809 12/27 (44%)
TPR repeat 146..176 CDD:276809 13/30 (43%)
TPR repeat 181..209 CDD:276809 10/34 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 78 1.000 Domainoid score I8614
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005389
OrthoInspector 1 1.000 - - otm47502
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.