DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb12 and AT1G53690

DIOPT Version :9

Sequence 1:NP_001097319.1 Gene:Rpb12 / 5740790 FlyBaseID:FBgn0262954 Length:57 Species:Drosophila melanogaster
Sequence 2:NP_001319215.1 Gene:AT1G53690 / 841806 AraportID:AT1G53690 Length:60 Species:Arabidopsis thaliana


Alignment Length:46 Identity:21/46 - (45%)
Similarity:31/46 - (67%) Gaps:1/46 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SETSSKDNVKTAMTYICGECHHENEMRPRDPIRCRECGYRIMYKKR 47
            |||..| ..:..:.|:||:|..||.::..|..:||:||:||:||||
plant     6 SETDDK-QPEQLVIYVCGDCGQENILKRGDVFQCRDCGFRILYKKR 50

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb12NP_001097319.1 RPOLCX 14..57 CDD:128906 17/34 (50%)
AT1G53690NP_001319215.1 RPOLCX 17..59 CDD:128906 17/34 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4169
eggNOG 1 0.900 - - E1_COG1996
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1620152at2759
OrthoFinder 1 1.000 - - FOG0004951
OrthoInspector 1 1.000 - - otm3026
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12056
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3493
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.880

Return to query results.
Submit another query.